Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A2ARP1

- VIP1_MOUSE

UniProt

A2ARP1 - VIP1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1

Gene

Ppip5k1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Bifunctional inositol kinase that acts in concert with the IP6K kinases IP6K1, IP6K2 and IP6K3 to synthesize the diphosphate group-containing inositol pyrophosphates diphosphoinositol pentakisphosphate, PP-InsP5, and bis-diphosphoinositol tetrakisphosphate, (PP)2-InsP4. PP-InsP5 and (PP)2-InsP4, also respectively called InsP7 and InsP8, regulate a variety of cellular processes, including apoptosis, vesicle trafficking, cytoskeletal dynamics, exocytosis, insulin signaling and neutrophil activation. Phosphorylates inositol hexakisphosphate (InsP6) at positions 1 or 3 to produce PP-InsP5 which is in turn phosphorylated by IP6Ks to produce (PP)2-InsP4. Alternatively, phosphorylates at position 1 or 3 PP-InsP5, produced by IP6Ks from InsP6, to produce (PP)2-InsP4. Activated when cells are exposed to hyperosmotic stress (By similarity).By similarity

Catalytic activityi

ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate.
ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.
ATP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.
ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei145 – 1451ATPBy similarity
Binding sitei198 – 1981ATPBy similarity
Binding sitei205 – 2051ATPBy similarity
Binding sitei224 – 2241ATPBy similarity
Binding sitei259 – 2591SubstrateBy similarity
Binding sitei273 – 2731SubstrateBy similarity
Binding sitei275 – 2751ATPBy similarity
Binding sitei320 – 3201ATPBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi248 – 2514ATPBy similarity
Nucleotide bindingi257 – 2593ATPBy similarity
Nucleotide bindingi332 – 3343ATPBy similarity

GO - Molecular functioni

  1. acid phosphatase activity Source: InterPro
  2. ATP binding Source: UniProtKB-KW
  3. diphosphoinositol-pentakisphosphate kinase activity Source: UniProtKB
  4. inositol-1,3,4,5,6-pentakisphosphate kinase activity Source: UniProtKB
  5. inositol hexakisphosphate 1-kinase activity Source: UniProtKB-EC
  6. inositol hexakisphosphate 3-kinase activity Source: UniProtKB-EC
  7. inositol hexakisphosphate 5-kinase activity Source: UniProtKB

GO - Biological processi

  1. inositol metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_196482. Synthesis of pyrophosphates in the cytosol.

Names & Taxonomyi

Protein namesi
Recommended name:
Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 (EC:2.7.4.21, EC:2.7.4.24)
Alternative name(s):
Diphosphoinositol pentakisphosphate kinase 1
Histidine acid phosphatase domain-containing protein 2A
InsP6 and PP-IP5 kinase 1
VIP1 homolog
Gene namesi
Name:Ppip5k1
Synonyms:Hisppd2a, Kiaa0377, Vip1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:2443281. Ppip5k1.

Subcellular locationi

Cytoplasmcytosol By similarity. Cell membrane By similarity
Note: Relocalizes to the plasma membrane upon activation of the PtdIns 3-kinase pathway.By similarity

GO - Cellular componenti

  1. cytosol Source: UniProtKB
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14361436Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1PRO_0000315689Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1147 – 11471PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiA2ARP1.
PaxDbiA2ARP1.
PRIDEiA2ARP1.

PTM databases

PhosphoSiteiA2ARP1.

Expressioni

Gene expression databases

BgeeiA2ARP1.
CleanExiMM_HISPPD2A.
ExpressionAtlasiA2ARP1. baseline and differential.
GenevestigatoriA2ARP1.

Structurei

3D structure databases

ProteinModelPortaliA2ARP1.
SMRiA2ARP1. Positions 54-371.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni64 – 652Substrate bindingBy similarity
Regioni224 – 2252Substrate bindingBy similarity
Regioni337 – 3404Substrate bindingBy similarity
Regioni382 – 45372Polyphosphoinositide-binding domainBy similarityAdd
BLAST

Domaini

The polyphosphoinositide-binding domain mediates binding of PtdIns(3,4,5)P3 and InsP6. Despite its similarity with the phosphatase domain of histidine acid phosphatases, it has no phosphatase activity (By similarity).By similarity

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG245915.
GeneTreeiENSGT00390000009048.
HOVERGENiHBG108657.
InParanoidiA2ARP1.
KOiK13024.
OMAiEEVSQPC.
OrthoDBiEOG77M8MT.
PhylomeDBiA2ARP1.
TreeFamiTF313594.

Family and domain databases

Gene3Di3.40.50.1240. 3 hits.
InterProiIPR000560. His_Pase_superF_clade-2.
IPR029033. His_PPase_superfam.
[Graphical view]
PfamiPF00328. His_Phos_2. 1 hit.
[Graphical view]
SUPFAMiSSF53254. SSF53254. 3 hits.
PROSITEiPS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A2ARP1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWSLTANEDE STTAHFFLGA GDEGLGTCGI GMRTEESDSE LLEDEEDEVP
60 70 80 90 100
PEPQIIVGIC AMTKKSKSKP MTQILERLCR FDYLTVVILG EDVILNEPVE
110 120 130 140 150
NWPSCHCLIS FHSKGFPLDK AVAYSKLRNP FLINDLAMQY YIQDRREVYR
160 170 180 190 200
ILQEEGIDLP RYAVLNRDPA CPEECSLIEG EDQVEVNGAV FPKPFVEKPV
210 220 230 240 250
SAEDHNVYIY YPSSAGGGSQ RLFRKIGSRS SVYSPESSVR KTGSYIYEEF
260 270 280 290 300
MPTDGTDVKV YTVGPDYAHA EARKSPALDG KVERDSEGKE VRYPVMLTAM
310 320 330 340 350
EKLVARKVCV AFKQTVCGFD LLRANGHSFV CDVNGFSFVK NSMKYYDDCA
360 370 380 390 400
KILGNTIMRE LAPQFQIPWS IPTEAEDIPI VPTTSGTMME LRCVIAIIRH
410 420 430 440 450
GDRTPKQKMK MEVTHPRFFA LFEKHGGYKT GKLKLKRPEQ LQEVLDITRL
460 470 480 490 500
LLAELEKEPE AEIEEKTGKL EQLKSVLEMY GHFSGINRKV QLTYYPHGVK
510 520 530 540 550
ASNEGQDLQR EPLAPSLLLV LKWGGELTPD GRVQAEELGR AFRCMYPGGQ
560 570 580 590 600
GDYAGFPGCG LLRLHSTFRH DLKIYASDEG RVQMTAAAFA KGLLALEGEL
610 620 630 640 650
TPILVQMVKS ANMNGLLDSD SDSLSSCQHR VKARLHHILQ QDAPFGPEDY
660 670 680 690 700
DQLAPTGSTS LLNSMSVIQN PVKVCDQVFA LIENLTHQIR ERMQDPSSVD
710 720 730 740 750
LQLYHSETLE LMLQRWSKLE RDFRQKSGRY DISKIPDIYD CVKYDVQHNG
760 770 780 790 800
SLGLQGTAEL LRLSKALADV VIPQEYGISR EEKVEIAVGF CLPLLRKILL
810 820 830 840 850
DLQRTHEDES VNKLHPLYSR GVLSPGRHVR TRLYFTSESH VHSLLSVFRY
860 870 880 890 900
GGLLDETQDA QWQRALAYLS AISELNYMTQ IVIMLYEDNT RDPLSEERFH
910 920 930 940 950
VELHFSPGVK GVEEGSAPAG CGFRPASSEN EEMKTDPGSI ENLCPGKASD
960 970 980 990 1000
EPDRALQTSP QPVEGTGLPR RSPLIRNRKA GSMEVLSETS SSRPGGYRLF
1010 1020 1030 1040 1050
SSSRPPTEMK QSGLGSQCTG LFSTTVLGGS SSAPNLQDYA RTHGKKLPPA
1060 1070 1080 1090 1100
SLKHRDELLF VPAVKRFSVS FAKHPTNGFE GCSMVPTIYP LETLHNALSL
1110 1120 1130 1140 1150
RQVSEFLTKV CQRHTDAHAQ ASAALFDSMH NHQASDSPFS PPRTLHSPPL
1160 1170 1180 1190 1200
QLRHRSEKPP WYSSGPSSTV SSAGPSSPTT VDGNSHFGFS DQSSVNIHMT
1210 1220 1230 1240 1250
EEKQGFGLLQ ETPGDGTREL HIERQQELVE PAQSPQELPV EICPSGSQGV
1260 1270 1280 1290 1300
TKVSQTCQEV PDIVQPCHNI HEEIGQPQQE VPDISQLLLK DHDTTTNTCH
1310 1320 1330 1340 1350
LCQASQLSQK VCEEICQLCQ DNHEESNQLC QEVSVKLGRM VHGFPVNVDS
1360 1370 1380 1390 1400
TAQETLMEIG RPTQEIPEDP YQEFSVKVGV LAQKAPAISE LSQDIPEADK
1410 1420 1430
PSQELSEETE LQAQEVSEEI DQESEVVDEL PPEAIS
Length:1,436
Mass (Da):159,923
Last modified:February 20, 2007 - v1
Checksum:iD160DDDA7F34B4F2
GO
Isoform 2 (identifier: A2ARP1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     818-837: Missing.

Note: No experimental confirmation available.

Show »
Length:1,416
Mass (Da):157,588
Checksum:i39D0CF8B9C48BF98
GO
Isoform 3 (identifier: A2ARP1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1057-1077: Missing.

Note: No experimental confirmation available.

Show »
Length:1,415
Mass (Da):157,553
Checksum:iF51E050A638DA33A
GO
Isoform 4 (identifier: A2ARP1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-266: YTVGPD → MVDAEI
     267-1436: Missing.

Note: No experimental confirmation available.

Show »
Length:266
Mass (Da):29,888
Checksum:i3058794BBECC2253
GO
Isoform 5 (identifier: A2ARP1-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     403-439: RTPKQKMKMEVTHPRFFALFEKHGGYKTGKLKLKRPE → HPSFVIEKLVPWRCCLKLHLQDLVATVCFHLHGHQQR
     440-1436: Missing.

Note: No experimental confirmation available.

Show »
Length:439
Mass (Da):49,416
Checksum:i5886DD464B506F60
GO
Isoform 6 (identifier: A2ARP1-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     653-671: LAPTGSTSLLNSMSVIQNP → VTLFSSPCSNYIATQFLKF
     672-1436: Missing.

Note: No experimental confirmation available.

Show »
Length:671
Mass (Da):75,262
Checksum:iDDF3D544D053FE04
GO

Sequence cautioni

The sequence BAC32838.1 differs from that shown. Reason: Intron retention.Curated
The sequence BAC37198.1 differs from that shown. Reason: Frameshift at position 42. Curated
The sequence BAC65546.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti441 – 4411L → I in BAC38780. (PubMed:16141072)Curated
Sequence conflicti831 – 8311T → A in BAC32838. (PubMed:16141072)Curated
Sequence conflicti1049 – 10491P → S in BAC65546. (PubMed:12693553)Curated
Sequence conflicti1180 – 11801T → A in AAP46293. 1 PublicationCurated
Sequence conflicti1180 – 11801T → A in BAC65546. (PubMed:12693553)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei261 – 2666YTVGPD → MVDAEI in isoform 4. 1 PublicationVSP_030625
Alternative sequencei267 – 14361170Missing in isoform 4. 1 PublicationVSP_030626Add
BLAST
Alternative sequencei403 – 43937RTPKQ…LKRPE → HPSFVIEKLVPWRCCLKLHL QDLVATVCFHLHGHQQR in isoform 5. 1 PublicationVSP_030627Add
BLAST
Alternative sequencei440 – 1436997Missing in isoform 5. 1 PublicationVSP_030628Add
BLAST
Alternative sequencei653 – 67119LAPTG…VIQNP → VTLFSSPCSNYIATQFLKF in isoform 6. 1 PublicationVSP_030629Add
BLAST
Alternative sequencei672 – 1436765Missing in isoform 6. 1 PublicationVSP_030630Add
BLAST
Alternative sequencei818 – 83720Missing in isoform 2. CuratedVSP_030631Add
BLAST
Alternative sequencei1057 – 107721Missing in isoform 3. CuratedVSP_030634Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF502585 mRNA. Translation: AAP46293.1.
AK122264 mRNA. Translation: BAC65546.1. Different initiation.
AK046696 mRNA. Translation: BAC32838.1. Sequence problems.
AK078268 mRNA. Translation: BAC37198.1. Frameshift.
AK083140 mRNA. Translation: BAC38780.1.
AL845466 Genomic DNA. Translation: CAM24220.1.
AL845466 Genomic DNA. Translation: CAM24221.1.
AL845466 Genomic DNA. Translation: CAM24222.1.
BC065138 mRNA. Translation: AAH65138.1.
CCDSiCCDS16639.1. [A2ARP1-1]
RefSeqiNP_848910.3. NM_178795.4. [A2ARP1-1]
XP_006499804.1. XM_006499741.1. [A2ARP1-1]
UniGeneiMm.386076.

Genome annotation databases

EnsembliENSMUST00000052029; ENSMUSP00000057632; ENSMUSG00000033526. [A2ARP1-1]
ENSMUST00000110625; ENSMUSP00000106255; ENSMUSG00000033526. [A2ARP1-3]
ENSMUST00000110626; ENSMUSP00000106256; ENSMUSG00000033526. [A2ARP1-1]
ENSMUST00000110627; ENSMUSP00000106257; ENSMUSG00000033526. [A2ARP1-3]
ENSMUST00000110628; ENSMUSP00000106258; ENSMUSG00000033526. [A2ARP1-2]
GeneIDi327655.
KEGGimmu:327655.
UCSCiuc008lyl.1. mouse. [A2ARP1-1]
uc008lyq.1. mouse. [A2ARP1-7]
uc008lyr.1. mouse. [A2ARP1-5]
uc008lys.1. mouse. [A2ARP1-6]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF502585 mRNA. Translation: AAP46293.1 .
AK122264 mRNA. Translation: BAC65546.1 . Different initiation.
AK046696 mRNA. Translation: BAC32838.1 . Sequence problems.
AK078268 mRNA. Translation: BAC37198.1 . Frameshift.
AK083140 mRNA. Translation: BAC38780.1 .
AL845466 Genomic DNA. Translation: CAM24220.1 .
AL845466 Genomic DNA. Translation: CAM24221.1 .
AL845466 Genomic DNA. Translation: CAM24222.1 .
BC065138 mRNA. Translation: AAH65138.1 .
CCDSi CCDS16639.1. [A2ARP1-1 ]
RefSeqi NP_848910.3. NM_178795.4. [A2ARP1-1 ]
XP_006499804.1. XM_006499741.1. [A2ARP1-1 ]
UniGenei Mm.386076.

3D structure databases

ProteinModelPortali A2ARP1.
SMRi A2ARP1. Positions 54-371.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei A2ARP1.

Proteomic databases

MaxQBi A2ARP1.
PaxDbi A2ARP1.
PRIDEi A2ARP1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000052029 ; ENSMUSP00000057632 ; ENSMUSG00000033526 . [A2ARP1-1 ]
ENSMUST00000110625 ; ENSMUSP00000106255 ; ENSMUSG00000033526 . [A2ARP1-3 ]
ENSMUST00000110626 ; ENSMUSP00000106256 ; ENSMUSG00000033526 . [A2ARP1-1 ]
ENSMUST00000110627 ; ENSMUSP00000106257 ; ENSMUSG00000033526 . [A2ARP1-3 ]
ENSMUST00000110628 ; ENSMUSP00000106258 ; ENSMUSG00000033526 . [A2ARP1-2 ]
GeneIDi 327655.
KEGGi mmu:327655.
UCSCi uc008lyl.1. mouse. [A2ARP1-1 ]
uc008lyq.1. mouse. [A2ARP1-7 ]
uc008lyr.1. mouse. [A2ARP1-5 ]
uc008lys.1. mouse. [A2ARP1-6 ]

Organism-specific databases

CTDi 9677.
MGIi MGI:2443281. Ppip5k1.
Rougei Search...

Phylogenomic databases

eggNOGi NOG245915.
GeneTreei ENSGT00390000009048.
HOVERGENi HBG108657.
InParanoidi A2ARP1.
KOi K13024.
OMAi EEVSQPC.
OrthoDBi EOG77M8MT.
PhylomeDBi A2ARP1.
TreeFami TF313594.

Enzyme and pathway databases

Reactomei REACT_196482. Synthesis of pyrophosphates in the cytosol.

Miscellaneous databases

NextBioi 397922.
PROi A2ARP1.
SOURCEi Search...

Gene expression databases

Bgeei A2ARP1.
CleanExi MM_HISPPD2A.
ExpressionAtlasi A2ARP1. baseline and differential.
Genevestigatori A2ARP1.

Family and domain databases

Gene3Di 3.40.50.1240. 3 hits.
InterProi IPR000560. His_Pase_superF_clade-2.
IPR029033. His_PPase_superfam.
[Graphical view ]
Pfami PF00328. His_Phos_2. 1 hit.
[Graphical view ]
SUPFAMi SSF53254. SSF53254. 3 hits.
PROSITEi PS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A 60kb genomic deletion is associated with non-syndromic deafness and sperm motility disorder but not with congenital dyserythropoietic anemia type I."
    Avidan N., Dgany O.D., Cattan D.C., Pariente A., Thulliez M., Borot N., Moati L., Alain B., Krasnov T., Olender T., Shalmon L., Ben-Asher E., Khen M., Shalev H., Fellous M., Delaunay J., Yaniv I., Zaizov R.
    , Beckmann J.S., Lancet D., Tamary H.
    Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Swiss Webster.
    Tissue: Brain.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6).
    Strain: C57BL/6J.
    Tissue: Adipose tissue, Hippocampus and Olfactory bulb.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: C57BL/6J.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Strain: C57BL/6.
    Tissue: Eye.

Entry informationi

Entry nameiVIP1_MOUSE
AccessioniPrimary (citable) accession number: A2ARP1
Secondary accession number(s): A2ARP2
, A2ARP3, A2ARP4, Q6P1C8, Q7TSP1, Q80U21, Q8BL16, Q8BUN6, Q8BVG9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: February 20, 2007
Last modified: October 29, 2014
This is version 76 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3