Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A2ARP1 (VIP1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 73. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1

EC=2.7.4.21
EC=2.7.4.24
Alternative name(s):
Diphosphoinositol pentakisphosphate kinase 1
Histidine acid phosphatase domain-containing protein 2A
InsP6 and PP-IP5 kinase 1
VIP1 homolog
Gene names
Name:Ppip5k1
Synonyms:Hisppd2a, Kiaa0377, Vip1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1436 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Bifunctional inositol kinase that acts in concert with the IP6K kinases IP6K1, IP6K2 and IP6K3 to synthesize the diphosphate group-containing inositol pyrophosphates diphosphoinositol pentakisphosphate, PP-InsP5, and bis-diphosphoinositol tetrakisphosphate, (PP)2-InsP4. PP-InsP5 and (PP)2-InsP4, also respectively called InsP7 and InsP8, regulate a variety of cellular processes, including apoptosis, vesicle trafficking, cytoskeletal dynamics, exocytosis, insulin signaling and neutrophil activation. Phosphorylates inositol hexakisphosphate (InsP6) at positions 1 or 3 to produce PP-InsP5 which is in turn phosphorylated by IP6Ks to produce (PP)2-InsP4. Alternatively, phosphorylates at position 1 or 3 PP-InsP5, produced by IP6Ks from InsP6, to produce (PP)2-InsP4. Activated when cells are exposed to hyperosmotic stress By similarity.

Catalytic activity

ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate.

ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.

ATP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.

ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate.

Subcellular location

Cytoplasmcytosol By similarity. Cell membrane By similarity. Note: Relocalizes to the plasma membrane upon activation of the PtdIns 3-kinase pathway By similarity.

Domain

The polyphosphoinositide-binding domain mediates binding of PtdIns(3,4,5)P3 and InsP6. Despite its similarity with the phosphatase domain of histidine acid phosphatases, it has no phosphatase activity By similarity.

Sequence similarities

Belongs to the histidine acid phosphatase family. VIP1 subfamily.

Sequence caution

The sequence BAC32838.1 differs from that shown. Reason: Intron retention.

The sequence BAC37198.1 differs from that shown. Reason: Frameshift at position 42.

The sequence BAC65546.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A2ARP1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A2ARP1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     818-837: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: A2ARP1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1057-1077: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: A2ARP1-5)

The sequence of this isoform differs from the canonical sequence as follows:
     261-266: YTVGPD → MVDAEI
     267-1436: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: A2ARP1-6)

The sequence of this isoform differs from the canonical sequence as follows:
     403-439: RTPKQKMKMEVTHPRFFALFEKHGGYKTGKLKLKRPE → HPSFVIEKLVPWRCCLKLHLQDLVATVCFHLHGHQQR
     440-1436: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: A2ARP1-7)

The sequence of this isoform differs from the canonical sequence as follows:
     653-671: LAPTGSTSLLNSMSVIQNP → VTLFSSPCSNYIATQFLKF
     672-1436: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 14361436Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1
PRO_0000315689

Regions

Nucleotide binding248 – 2514ATP By similarity
Nucleotide binding257 – 2593ATP By similarity
Nucleotide binding332 – 3343ATP By similarity
Region64 – 652Substrate binding By similarity
Region224 – 2252Substrate binding By similarity
Region337 – 3404Substrate binding By similarity
Region382 – 45372Polyphosphoinositide-binding domain By similarity

Sites

Binding site1451ATP By similarity
Binding site1981ATP By similarity
Binding site2051ATP By similarity
Binding site2241ATP By similarity
Binding site2591Substrate By similarity
Binding site2731Substrate By similarity
Binding site2751ATP By similarity
Binding site3201ATP By similarity

Amino acid modifications

Modified residue11471Phosphoserine By similarity

Natural variations

Alternative sequence261 – 2666YTVGPD → MVDAEI in isoform 4.
VSP_030625
Alternative sequence267 – 14361170Missing in isoform 4.
VSP_030626
Alternative sequence403 – 43937RTPKQ…LKRPE → HPSFVIEKLVPWRCCLKLHL QDLVATVCFHLHGHQQR in isoform 5.
VSP_030627
Alternative sequence440 – 1436997Missing in isoform 5.
VSP_030628
Alternative sequence653 – 67119LAPTG…VIQNP → VTLFSSPCSNYIATQFLKF in isoform 6.
VSP_030629
Alternative sequence672 – 1436765Missing in isoform 6.
VSP_030630
Alternative sequence818 – 83720Missing in isoform 2.
VSP_030631
Alternative sequence1057 – 107721Missing in isoform 3.
VSP_030634

Experimental info

Sequence conflict4411L → I in BAC38780. Ref.3
Sequence conflict8311T → A in BAC32838. Ref.3
Sequence conflict10491P → S in BAC65546. Ref.2
Sequence conflict11801T → A in AAP46293. Ref.1
Sequence conflict11801T → A in BAC65546. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 20, 2007. Version 1.
Checksum: D160DDDA7F34B4F2

FASTA1,436159,923
        10         20         30         40         50         60 
MWSLTANEDE STTAHFFLGA GDEGLGTCGI GMRTEESDSE LLEDEEDEVP PEPQIIVGIC 

        70         80         90        100        110        120 
AMTKKSKSKP MTQILERLCR FDYLTVVILG EDVILNEPVE NWPSCHCLIS FHSKGFPLDK 

       130        140        150        160        170        180 
AVAYSKLRNP FLINDLAMQY YIQDRREVYR ILQEEGIDLP RYAVLNRDPA CPEECSLIEG 

       190        200        210        220        230        240 
EDQVEVNGAV FPKPFVEKPV SAEDHNVYIY YPSSAGGGSQ RLFRKIGSRS SVYSPESSVR 

       250        260        270        280        290        300 
KTGSYIYEEF MPTDGTDVKV YTVGPDYAHA EARKSPALDG KVERDSEGKE VRYPVMLTAM 

       310        320        330        340        350        360 
EKLVARKVCV AFKQTVCGFD LLRANGHSFV CDVNGFSFVK NSMKYYDDCA KILGNTIMRE 

       370        380        390        400        410        420 
LAPQFQIPWS IPTEAEDIPI VPTTSGTMME LRCVIAIIRH GDRTPKQKMK MEVTHPRFFA 

       430        440        450        460        470        480 
LFEKHGGYKT GKLKLKRPEQ LQEVLDITRL LLAELEKEPE AEIEEKTGKL EQLKSVLEMY 

       490        500        510        520        530        540 
GHFSGINRKV QLTYYPHGVK ASNEGQDLQR EPLAPSLLLV LKWGGELTPD GRVQAEELGR 

       550        560        570        580        590        600 
AFRCMYPGGQ GDYAGFPGCG LLRLHSTFRH DLKIYASDEG RVQMTAAAFA KGLLALEGEL 

       610        620        630        640        650        660 
TPILVQMVKS ANMNGLLDSD SDSLSSCQHR VKARLHHILQ QDAPFGPEDY DQLAPTGSTS 

       670        680        690        700        710        720 
LLNSMSVIQN PVKVCDQVFA LIENLTHQIR ERMQDPSSVD LQLYHSETLE LMLQRWSKLE 

       730        740        750        760        770        780 
RDFRQKSGRY DISKIPDIYD CVKYDVQHNG SLGLQGTAEL LRLSKALADV VIPQEYGISR 

       790        800        810        820        830        840 
EEKVEIAVGF CLPLLRKILL DLQRTHEDES VNKLHPLYSR GVLSPGRHVR TRLYFTSESH 

       850        860        870        880        890        900 
VHSLLSVFRY GGLLDETQDA QWQRALAYLS AISELNYMTQ IVIMLYEDNT RDPLSEERFH 

       910        920        930        940        950        960 
VELHFSPGVK GVEEGSAPAG CGFRPASSEN EEMKTDPGSI ENLCPGKASD EPDRALQTSP 

       970        980        990       1000       1010       1020 
QPVEGTGLPR RSPLIRNRKA GSMEVLSETS SSRPGGYRLF SSSRPPTEMK QSGLGSQCTG 

      1030       1040       1050       1060       1070       1080 
LFSTTVLGGS SSAPNLQDYA RTHGKKLPPA SLKHRDELLF VPAVKRFSVS FAKHPTNGFE 

      1090       1100       1110       1120       1130       1140 
GCSMVPTIYP LETLHNALSL RQVSEFLTKV CQRHTDAHAQ ASAALFDSMH NHQASDSPFS 

      1150       1160       1170       1180       1190       1200 
PPRTLHSPPL QLRHRSEKPP WYSSGPSSTV SSAGPSSPTT VDGNSHFGFS DQSSVNIHMT 

      1210       1220       1230       1240       1250       1260 
EEKQGFGLLQ ETPGDGTREL HIERQQELVE PAQSPQELPV EICPSGSQGV TKVSQTCQEV 

      1270       1280       1290       1300       1310       1320 
PDIVQPCHNI HEEIGQPQQE VPDISQLLLK DHDTTTNTCH LCQASQLSQK VCEEICQLCQ 

      1330       1340       1350       1360       1370       1380 
DNHEESNQLC QEVSVKLGRM VHGFPVNVDS TAQETLMEIG RPTQEIPEDP YQEFSVKVGV 

      1390       1400       1410       1420       1430 
LAQKAPAISE LSQDIPEADK PSQELSEETE LQAQEVSEEI DQESEVVDEL PPEAIS 

« Hide

Isoform 2 [UniParc].

Checksum: 39D0CF8B9C48BF98
Show »

FASTA1,416157,588
Isoform 3 [UniParc].

Checksum: F51E050A638DA33A
Show »

FASTA1,415157,553
Isoform 4 [UniParc].

Checksum: 3058794BBECC2253
Show »

FASTA26629,888
Isoform 5 [UniParc].

Checksum: 5886DD464B506F60
Show »

FASTA43949,416
Isoform 6 [UniParc].

Checksum: DDF3D544D053FE04
Show »

FASTA67175,262

References

« Hide 'large scale' references
[1]"A 60kb genomic deletion is associated with non-syndromic deafness and sperm motility disorder but not with congenital dyserythropoietic anemia type I."
Avidan N., Dgany O.D., Cattan D.C., Pariente A., Thulliez M., Borot N., Moati L., Alain B., Krasnov T., Olender T., Shalmon L., Ben-Asher E., Khen M., Shalev H., Fellous M., Delaunay J., Yaniv I., Zaizov R. expand/collapse author list , Beckmann J.S., Lancet D., Tamary H.
Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: Swiss Webster.
Tissue: Brain.
[2]"Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6).
Strain: C57BL/6J.
Tissue: Adipose tissue, Hippocampus and Olfactory bulb.
[4]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
Strain: C57BL/6J.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
Strain: C57BL/6.
Tissue: Eye.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF502585 mRNA. Translation: AAP46293.1.
AK122264 mRNA. Translation: BAC65546.1. Different initiation.
AK046696 mRNA. Translation: BAC32838.1. Sequence problems.
AK078268 mRNA. Translation: BAC37198.1. Frameshift.
AK083140 mRNA. Translation: BAC38780.1.
AL845466 Genomic DNA. Translation: CAM24220.1.
AL845466 Genomic DNA. Translation: CAM24221.1.
AL845466 Genomic DNA. Translation: CAM24222.1.
BC065138 mRNA. Translation: AAH65138.1.
CCDSCCDS16639.1. [A2ARP1-1]
RefSeqNP_848910.3. NM_178795.4. [A2ARP1-1]
XP_006499804.1. XM_006499741.1. [A2ARP1-1]
UniGeneMm.386076.

3D structure databases

ProteinModelPortalA2ARP1.
SMRA2ARP1. Positions 54-371.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteA2ARP1.

Proteomic databases

PaxDbA2ARP1.
PRIDEA2ARP1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000052029; ENSMUSP00000057632; ENSMUSG00000033526. [A2ARP1-1]
ENSMUST00000110625; ENSMUSP00000106255; ENSMUSG00000033526. [A2ARP1-3]
ENSMUST00000110626; ENSMUSP00000106256; ENSMUSG00000033526. [A2ARP1-1]
ENSMUST00000110627; ENSMUSP00000106257; ENSMUSG00000033526. [A2ARP1-3]
ENSMUST00000110628; ENSMUSP00000106258; ENSMUSG00000033526. [A2ARP1-2]
GeneID327655.
KEGGmmu:327655.
UCSCuc008lyl.1. mouse. [A2ARP1-1]
uc008lyq.1. mouse. [A2ARP1-7]
uc008lyr.1. mouse. [A2ARP1-5]
uc008lys.1. mouse. [A2ARP1-6]

Organism-specific databases

CTD9677.
MGIMGI:2443281. Ppip5k1.
RougeSearch...

Phylogenomic databases

eggNOGNOG245915.
GeneTreeENSGT00390000009048.
HOVERGENHBG108657.
InParanoidA2ARP1.
KOK13024.
OMAEEVSQPC.
OrthoDBEOG77M8MT.
PhylomeDBA2ARP1.
TreeFamTF313594.

Gene expression databases

ArrayExpressA2ARP1.
BgeeA2ARP1.
CleanExMM_HISPPD2A.
GenevestigatorA2ARP1.

Family and domain databases

Gene3D3.40.50.1240. 3 hits.
InterProIPR000560. His_Pase_superF_clade-2.
IPR029033. His_PPase_superfam.
[Graphical view]
PfamPF00328. His_Phos_2. 1 hit.
[Graphical view]
SUPFAMSSF53254. SSF53254. 3 hits.
PROSITEPS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio397922.
PROA2ARP1.
SOURCESearch...

Entry information

Entry nameVIP1_MOUSE
AccessionPrimary (citable) accession number: A2ARP1
Secondary accession number(s): A2ARP2 expand/collapse secondary AC list , A2ARP3, A2ARP4, Q6P1C8, Q7TSP1, Q80U21, Q8BL16, Q8BUN6, Q8BVG9
Entry history
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: February 20, 2007
Last modified: July 9, 2014
This is version 73 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot