Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A2ARP1

- VIP1_MOUSE

UniProt

A2ARP1 - VIP1_MOUSE

Protein

Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1

Gene

Ppip5k1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 75 (01 Oct 2014)
      Sequence version 1 (20 Feb 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Bifunctional inositol kinase that acts in concert with the IP6K kinases IP6K1, IP6K2 and IP6K3 to synthesize the diphosphate group-containing inositol pyrophosphates diphosphoinositol pentakisphosphate, PP-InsP5, and bis-diphosphoinositol tetrakisphosphate, (PP)2-InsP4. PP-InsP5 and (PP)2-InsP4, also respectively called InsP7 and InsP8, regulate a variety of cellular processes, including apoptosis, vesicle trafficking, cytoskeletal dynamics, exocytosis, insulin signaling and neutrophil activation. Phosphorylates inositol hexakisphosphate (InsP6) at positions 1 or 3 to produce PP-InsP5 which is in turn phosphorylated by IP6Ks to produce (PP)2-InsP4. Alternatively, phosphorylates at position 1 or 3 PP-InsP5, produced by IP6Ks from InsP6, to produce (PP)2-InsP4. Activated when cells are exposed to hyperosmotic stress By similarity.By similarity

    Catalytic activityi

    ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate.
    ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.
    ATP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.
    ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei145 – 1451ATPBy similarity
    Binding sitei198 – 1981ATPBy similarity
    Binding sitei205 – 2051ATPBy similarity
    Binding sitei224 – 2241ATPBy similarity
    Binding sitei259 – 2591SubstrateBy similarity
    Binding sitei273 – 2731SubstrateBy similarity
    Binding sitei275 – 2751ATPBy similarity
    Binding sitei320 – 3201ATPBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi248 – 2514ATPBy similarity
    Nucleotide bindingi257 – 2593ATPBy similarity
    Nucleotide bindingi332 – 3343ATPBy similarity

    GO - Molecular functioni

    1. acid phosphatase activity Source: InterPro
    2. ATP binding Source: UniProtKB-KW
    3. diphosphoinositol-pentakisphosphate kinase activity Source: UniProtKB
    4. inositol-1,3,4,5,6-pentakisphosphate kinase activity Source: UniProtKB
    5. inositol hexakisphosphate 1-kinase activity Source: UniProtKB-EC
    6. inositol hexakisphosphate 3-kinase activity Source: UniProtKB-EC
    7. inositol hexakisphosphate 5-kinase activity Source: UniProtKB

    GO - Biological processi

    1. inositol metabolic process Source: UniProtKB

    Keywords - Molecular functioni

    Kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_196482. Synthesis of pyrophosphates in the cytosol.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 (EC:2.7.4.21, EC:2.7.4.24)
    Alternative name(s):
    Diphosphoinositol pentakisphosphate kinase 1
    Histidine acid phosphatase domain-containing protein 2A
    InsP6 and PP-IP5 kinase 1
    VIP1 homolog
    Gene namesi
    Name:Ppip5k1
    Synonyms:Hisppd2a, Kiaa0377, Vip1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:2443281. Ppip5k1.

    Subcellular locationi

    Cytoplasmcytosol By similarity. Cell membrane By similarity
    Note: Relocalizes to the plasma membrane upon activation of the PtdIns 3-kinase pathway.By similarity

    GO - Cellular componenti

    1. cytosol Source: UniProtKB
    2. nucleus Source: Ensembl
    3. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 14361436Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1PRO_0000315689Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1147 – 11471PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiA2ARP1.
    PRIDEiA2ARP1.

    PTM databases

    PhosphoSiteiA2ARP1.

    Expressioni

    Gene expression databases

    ArrayExpressiA2ARP1.
    BgeeiA2ARP1.
    CleanExiMM_HISPPD2A.
    GenevestigatoriA2ARP1.

    Structurei

    3D structure databases

    ProteinModelPortaliA2ARP1.
    SMRiA2ARP1. Positions 54-371.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni64 – 652Substrate bindingBy similarity
    Regioni224 – 2252Substrate bindingBy similarity
    Regioni337 – 3404Substrate bindingBy similarity
    Regioni382 – 45372Polyphosphoinositide-binding domainBy similarityAdd
    BLAST

    Domaini

    The polyphosphoinositide-binding domain mediates binding of PtdIns(3,4,5)P3 and InsP6. Despite its similarity with the phosphatase domain of histidine acid phosphatases, it has no phosphatase activity By similarity.By similarity

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG245915.
    GeneTreeiENSGT00390000009048.
    HOVERGENiHBG108657.
    InParanoidiA2ARP1.
    KOiK13024.
    OMAiEEVSQPC.
    OrthoDBiEOG77M8MT.
    PhylomeDBiA2ARP1.
    TreeFamiTF313594.

    Family and domain databases

    Gene3Di3.40.50.1240. 3 hits.
    InterProiIPR000560. His_Pase_superF_clade-2.
    IPR029033. His_PPase_superfam.
    [Graphical view]
    PfamiPF00328. His_Phos_2. 1 hit.
    [Graphical view]
    SUPFAMiSSF53254. SSF53254. 3 hits.
    PROSITEiPS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A2ARP1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MWSLTANEDE STTAHFFLGA GDEGLGTCGI GMRTEESDSE LLEDEEDEVP     50
    PEPQIIVGIC AMTKKSKSKP MTQILERLCR FDYLTVVILG EDVILNEPVE 100
    NWPSCHCLIS FHSKGFPLDK AVAYSKLRNP FLINDLAMQY YIQDRREVYR 150
    ILQEEGIDLP RYAVLNRDPA CPEECSLIEG EDQVEVNGAV FPKPFVEKPV 200
    SAEDHNVYIY YPSSAGGGSQ RLFRKIGSRS SVYSPESSVR KTGSYIYEEF 250
    MPTDGTDVKV YTVGPDYAHA EARKSPALDG KVERDSEGKE VRYPVMLTAM 300
    EKLVARKVCV AFKQTVCGFD LLRANGHSFV CDVNGFSFVK NSMKYYDDCA 350
    KILGNTIMRE LAPQFQIPWS IPTEAEDIPI VPTTSGTMME LRCVIAIIRH 400
    GDRTPKQKMK MEVTHPRFFA LFEKHGGYKT GKLKLKRPEQ LQEVLDITRL 450
    LLAELEKEPE AEIEEKTGKL EQLKSVLEMY GHFSGINRKV QLTYYPHGVK 500
    ASNEGQDLQR EPLAPSLLLV LKWGGELTPD GRVQAEELGR AFRCMYPGGQ 550
    GDYAGFPGCG LLRLHSTFRH DLKIYASDEG RVQMTAAAFA KGLLALEGEL 600
    TPILVQMVKS ANMNGLLDSD SDSLSSCQHR VKARLHHILQ QDAPFGPEDY 650
    DQLAPTGSTS LLNSMSVIQN PVKVCDQVFA LIENLTHQIR ERMQDPSSVD 700
    LQLYHSETLE LMLQRWSKLE RDFRQKSGRY DISKIPDIYD CVKYDVQHNG 750
    SLGLQGTAEL LRLSKALADV VIPQEYGISR EEKVEIAVGF CLPLLRKILL 800
    DLQRTHEDES VNKLHPLYSR GVLSPGRHVR TRLYFTSESH VHSLLSVFRY 850
    GGLLDETQDA QWQRALAYLS AISELNYMTQ IVIMLYEDNT RDPLSEERFH 900
    VELHFSPGVK GVEEGSAPAG CGFRPASSEN EEMKTDPGSI ENLCPGKASD 950
    EPDRALQTSP QPVEGTGLPR RSPLIRNRKA GSMEVLSETS SSRPGGYRLF 1000
    SSSRPPTEMK QSGLGSQCTG LFSTTVLGGS SSAPNLQDYA RTHGKKLPPA 1050
    SLKHRDELLF VPAVKRFSVS FAKHPTNGFE GCSMVPTIYP LETLHNALSL 1100
    RQVSEFLTKV CQRHTDAHAQ ASAALFDSMH NHQASDSPFS PPRTLHSPPL 1150
    QLRHRSEKPP WYSSGPSSTV SSAGPSSPTT VDGNSHFGFS DQSSVNIHMT 1200
    EEKQGFGLLQ ETPGDGTREL HIERQQELVE PAQSPQELPV EICPSGSQGV 1250
    TKVSQTCQEV PDIVQPCHNI HEEIGQPQQE VPDISQLLLK DHDTTTNTCH 1300
    LCQASQLSQK VCEEICQLCQ DNHEESNQLC QEVSVKLGRM VHGFPVNVDS 1350
    TAQETLMEIG RPTQEIPEDP YQEFSVKVGV LAQKAPAISE LSQDIPEADK 1400
    PSQELSEETE LQAQEVSEEI DQESEVVDEL PPEAIS 1436
    Length:1,436
    Mass (Da):159,923
    Last modified:February 20, 2007 - v1
    Checksum:iD160DDDA7F34B4F2
    GO
    Isoform 2 (identifier: A2ARP1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         818-837: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,416
    Mass (Da):157,588
    Checksum:i39D0CF8B9C48BF98
    GO
    Isoform 3 (identifier: A2ARP1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1057-1077: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,415
    Mass (Da):157,553
    Checksum:iF51E050A638DA33A
    GO
    Isoform 4 (identifier: A2ARP1-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         261-266: YTVGPD → MVDAEI
         267-1436: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:266
    Mass (Da):29,888
    Checksum:i3058794BBECC2253
    GO
    Isoform 5 (identifier: A2ARP1-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         403-439: RTPKQKMKMEVTHPRFFALFEKHGGYKTGKLKLKRPE → HPSFVIEKLVPWRCCLKLHLQDLVATVCFHLHGHQQR
         440-1436: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:439
    Mass (Da):49,416
    Checksum:i5886DD464B506F60
    GO
    Isoform 6 (identifier: A2ARP1-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         653-671: LAPTGSTSLLNSMSVIQNP → VTLFSSPCSNYIATQFLKF
         672-1436: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:671
    Mass (Da):75,262
    Checksum:iDDF3D544D053FE04
    GO

    Sequence cautioni

    The sequence BAC32838.1 differs from that shown. Reason: Intron retention.
    The sequence BAC37198.1 differs from that shown. Reason: Frameshift at position 42.
    The sequence BAC65546.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti441 – 4411L → I in BAC38780. (PubMed:16141072)Curated
    Sequence conflicti831 – 8311T → A in BAC32838. (PubMed:16141072)Curated
    Sequence conflicti1049 – 10491P → S in BAC65546. (PubMed:12693553)Curated
    Sequence conflicti1180 – 11801T → A in AAP46293. 1 PublicationCurated
    Sequence conflicti1180 – 11801T → A in BAC65546. (PubMed:12693553)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei261 – 2666YTVGPD → MVDAEI in isoform 4. 1 PublicationVSP_030625
    Alternative sequencei267 – 14361170Missing in isoform 4. 1 PublicationVSP_030626Add
    BLAST
    Alternative sequencei403 – 43937RTPKQ…LKRPE → HPSFVIEKLVPWRCCLKLHL QDLVATVCFHLHGHQQR in isoform 5. 1 PublicationVSP_030627Add
    BLAST
    Alternative sequencei440 – 1436997Missing in isoform 5. 1 PublicationVSP_030628Add
    BLAST
    Alternative sequencei653 – 67119LAPTG…VIQNP → VTLFSSPCSNYIATQFLKF in isoform 6. 1 PublicationVSP_030629Add
    BLAST
    Alternative sequencei672 – 1436765Missing in isoform 6. 1 PublicationVSP_030630Add
    BLAST
    Alternative sequencei818 – 83720Missing in isoform 2. CuratedVSP_030631Add
    BLAST
    Alternative sequencei1057 – 107721Missing in isoform 3. CuratedVSP_030634Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF502585 mRNA. Translation: AAP46293.1.
    AK122264 mRNA. Translation: BAC65546.1. Different initiation.
    AK046696 mRNA. Translation: BAC32838.1. Sequence problems.
    AK078268 mRNA. Translation: BAC37198.1. Frameshift.
    AK083140 mRNA. Translation: BAC38780.1.
    AL845466 Genomic DNA. Translation: CAM24220.1.
    AL845466 Genomic DNA. Translation: CAM24221.1.
    AL845466 Genomic DNA. Translation: CAM24222.1.
    BC065138 mRNA. Translation: AAH65138.1.
    CCDSiCCDS16639.1. [A2ARP1-1]
    RefSeqiNP_848910.3. NM_178795.4. [A2ARP1-1]
    XP_006499804.1. XM_006499741.1. [A2ARP1-1]
    UniGeneiMm.386076.

    Genome annotation databases

    EnsembliENSMUST00000052029; ENSMUSP00000057632; ENSMUSG00000033526. [A2ARP1-1]
    ENSMUST00000110625; ENSMUSP00000106255; ENSMUSG00000033526. [A2ARP1-3]
    ENSMUST00000110626; ENSMUSP00000106256; ENSMUSG00000033526. [A2ARP1-1]
    ENSMUST00000110627; ENSMUSP00000106257; ENSMUSG00000033526. [A2ARP1-3]
    ENSMUST00000110628; ENSMUSP00000106258; ENSMUSG00000033526. [A2ARP1-2]
    GeneIDi327655.
    KEGGimmu:327655.
    UCSCiuc008lyl.1. mouse. [A2ARP1-1]
    uc008lyq.1. mouse. [A2ARP1-7]
    uc008lyr.1. mouse. [A2ARP1-5]
    uc008lys.1. mouse. [A2ARP1-6]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF502585 mRNA. Translation: AAP46293.1 .
    AK122264 mRNA. Translation: BAC65546.1 . Different initiation.
    AK046696 mRNA. Translation: BAC32838.1 . Sequence problems.
    AK078268 mRNA. Translation: BAC37198.1 . Frameshift.
    AK083140 mRNA. Translation: BAC38780.1 .
    AL845466 Genomic DNA. Translation: CAM24220.1 .
    AL845466 Genomic DNA. Translation: CAM24221.1 .
    AL845466 Genomic DNA. Translation: CAM24222.1 .
    BC065138 mRNA. Translation: AAH65138.1 .
    CCDSi CCDS16639.1. [A2ARP1-1 ]
    RefSeqi NP_848910.3. NM_178795.4. [A2ARP1-1 ]
    XP_006499804.1. XM_006499741.1. [A2ARP1-1 ]
    UniGenei Mm.386076.

    3D structure databases

    ProteinModelPortali A2ARP1.
    SMRi A2ARP1. Positions 54-371.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei A2ARP1.

    Proteomic databases

    PaxDbi A2ARP1.
    PRIDEi A2ARP1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000052029 ; ENSMUSP00000057632 ; ENSMUSG00000033526 . [A2ARP1-1 ]
    ENSMUST00000110625 ; ENSMUSP00000106255 ; ENSMUSG00000033526 . [A2ARP1-3 ]
    ENSMUST00000110626 ; ENSMUSP00000106256 ; ENSMUSG00000033526 . [A2ARP1-1 ]
    ENSMUST00000110627 ; ENSMUSP00000106257 ; ENSMUSG00000033526 . [A2ARP1-3 ]
    ENSMUST00000110628 ; ENSMUSP00000106258 ; ENSMUSG00000033526 . [A2ARP1-2 ]
    GeneIDi 327655.
    KEGGi mmu:327655.
    UCSCi uc008lyl.1. mouse. [A2ARP1-1 ]
    uc008lyq.1. mouse. [A2ARP1-7 ]
    uc008lyr.1. mouse. [A2ARP1-5 ]
    uc008lys.1. mouse. [A2ARP1-6 ]

    Organism-specific databases

    CTDi 9677.
    MGIi MGI:2443281. Ppip5k1.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG245915.
    GeneTreei ENSGT00390000009048.
    HOVERGENi HBG108657.
    InParanoidi A2ARP1.
    KOi K13024.
    OMAi EEVSQPC.
    OrthoDBi EOG77M8MT.
    PhylomeDBi A2ARP1.
    TreeFami TF313594.

    Enzyme and pathway databases

    Reactomei REACT_196482. Synthesis of pyrophosphates in the cytosol.

    Miscellaneous databases

    NextBioi 397922.
    PROi A2ARP1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi A2ARP1.
    Bgeei A2ARP1.
    CleanExi MM_HISPPD2A.
    Genevestigatori A2ARP1.

    Family and domain databases

    Gene3Di 3.40.50.1240. 3 hits.
    InterProi IPR000560. His_Pase_superF_clade-2.
    IPR029033. His_PPase_superfam.
    [Graphical view ]
    Pfami PF00328. His_Phos_2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53254. SSF53254. 3 hits.
    PROSITEi PS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A 60kb genomic deletion is associated with non-syndromic deafness and sperm motility disorder but not with congenital dyserythropoietic anemia type I."
      Avidan N., Dgany O.D., Cattan D.C., Pariente A., Thulliez M., Borot N., Moati L., Alain B., Krasnov T., Olender T., Shalmon L., Ben-Asher E., Khen M., Shalev H., Fellous M., Delaunay J., Yaniv I., Zaizov R.
      , Beckmann J.S., Lancet D., Tamary H.
      Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: Swiss Webster.
      Tissue: Brain.
    2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
      DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6).
      Strain: C57BL/6J.
      Tissue: Adipose tissue, Hippocampus and Olfactory bulb.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
      Strain: C57BL/6J.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Strain: C57BL/6.
      Tissue: Eye.

    Entry informationi

    Entry nameiVIP1_MOUSE
    AccessioniPrimary (citable) accession number: A2ARP1
    Secondary accession number(s): A2ARP2
    , A2ARP3, A2ARP4, Q6P1C8, Q7TSP1, Q80U21, Q8BL16, Q8BUN6, Q8BVG9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 15, 2008
    Last sequence update: February 20, 2007
    Last modified: October 1, 2014
    This is version 75 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3