A2ARP1 (VIP1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 62.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 EC=2.7.4.21 EC=2.7.4.24 Alternative name(s): Diphosphoinositol pentakisphosphate kinase 1 Histidine acid phosphatase domain-containing protein 2A InsP6 and PP-IP5 kinase 1 VIP1 homolog | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1436 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Bifunctional inositol kinase that acts in concert with the IP6K kinases IP6K1, IP6K2 and IP6K3 to synthesize the diphosphate group-containing inositol pyrophosphates diphosphoinositol pentakisphosphate, PP-InsP5, and bis-diphosphoinositol tetrakisphosphate, (PP)2-InsP4. PP-InsP5 and (PP)2-InsP4, also respectively called InsP7 and InsP8, regulate a variety of cellular processes, including apoptosis, vesicle trafficking, cytoskeletal dynamics, exocytosis, insulin signaling and neutrophil activation. Phosphorylates inositol hexakisphosphate (InsP6) at positions 1 or 3 to produce PP-InsP5 which is in turn phosphorylated by IP6Ks to produce (PP)2-InsP4. Alternatively, phosphorylates at position 1 or 3 PP-InsP5, produced by IP6Ks from InsP6, to produce (PP)2-InsP4. Activated when cells are exposed to hyperosmotic stress By similarity. |
| Catalytic activity | ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate. ATP + 1D-myo-inositol 1,3,4,5,6-pentakisphosphate = ADP + 1D-myo-inositol diphosphate tetrakisphosphate (isomeric configuration unknown). ATP + 1D-myo-inositol 5-diphosphate pentakisphosphate = ADP + 1D-myo-inositol bisdiphosphate tetrakisphosphate (isomeric configuration unknown). |
| Subcellular location | Cytoplasm › cytosol By similarity. Cell membrane By similarity. Note: Relocalizes to the plasma membrane upon activation of the PtdIns 3-kinase pathway By similarity. |
| Domain | The polyphosphoinositide-binding domain mediates binding of PtdIns(3,4,5)P3 and InsP6. Despite its similarity with the phosphatase domain of histidine acid phosphatases, it has no phosphatase activity By similarity. |
| Sequence similarities | Belongs to the histidine acid phosphatase family. VIP1 subfamily. |
| Sequence caution | The sequence BAC32838.1 differs from that shown. Reason: Intron retention. The sequence BAC37198.1 differs from that shown. Reason: Frameshift at position 42. The sequence BAC65546.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A2ARP1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A2ARP1-2) The sequence of this isoform differs from the canonical sequence as follows: 818-837: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: A2ARP1-3) The sequence of this isoform differs from the canonical sequence as follows: 1057-1077: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: A2ARP1-5) The sequence of this isoform differs from the canonical sequence as follows: 261-266: YTVGPD → MVDAEI 267-1436: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: A2ARP1-6) The sequence of this isoform differs from the canonical sequence as follows: 403-439: RTPKQKMKMEVTHPRFFALFEKHGGYKTGKLKLKRPE → HPSFVIEKLVPWRCCLKLHLQDLVATVCFHLHGHQQR 440-1436: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: A2ARP1-7) The sequence of this isoform differs from the canonical sequence as follows: 653-671: LAPTGSTSLLNSMSVIQNP → VTLFSSPCSNYIATQFLKF 672-1436: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1436 | 1436 | Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 | PRO_0000315689 | |||||
Regions | |||||||||
| Nucleotide binding | 248 – 251 | 4 | ATP By similarity | ||||||
| Nucleotide binding | 257 – 259 | 3 | ATP By similarity | ||||||
| Nucleotide binding | 332 – 334 | 3 | ATP By similarity | ||||||
| Region | 64 – 65 | 2 | Substrate binding By similarity | ||||||
| Region | 224 – 225 | 2 | Substrate binding By similarity | ||||||
| Region | 337 – 340 | 4 | Substrate binding By similarity | ||||||
| Region | 382 – 453 | 72 | Polyphosphoinositide-binding domain By similarity | ||||||
Sites | |||||||||
| Binding site | 145 | 1 | ATP By similarity | ||||||
| Binding site | 198 | 1 | ATP By similarity | ||||||
| Binding site | 205 | 1 | ATP By similarity | ||||||
| Binding site | 224 | 1 | ATP By similarity | ||||||
| Binding site | 259 | 1 | Substrate By similarity | ||||||
| Binding site | 273 | 1 | Substrate By similarity | ||||||
| Binding site | 275 | 1 | ATP By similarity | ||||||
| Binding site | 320 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1147 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 261 – 266 | 6 | YTVGPD → MVDAEI in isoform 4. | VSP_030625 | |||||
| Alternative sequence | 267 – 1436 | 1170 | Missing in isoform 4. | VSP_030626 | |||||
| Alternative sequence | 403 – 439 | 37 | RTPKQ…LKRPE → HPSFVIEKLVPWRCCLKLHL QDLVATVCFHLHGHQQR in isoform 5. | VSP_030627 | |||||
| Alternative sequence | 440 – 1436 | 997 | Missing in isoform 5. | VSP_030628 | |||||
| Alternative sequence | 653 – 671 | 19 | LAPTG…VIQNP → VTLFSSPCSNYIATQFLKF in isoform 6. | VSP_030629 | |||||
| Alternative sequence | 672 – 1436 | 765 | Missing in isoform 6. | VSP_030630 | |||||
| Alternative sequence | 818 – 837 | 20 | Missing in isoform 2. | VSP_030631 | |||||
| Alternative sequence | 1057 – 1077 | 21 | Missing in isoform 3. | VSP_030634 | |||||
Experimental info | |||||||||
| Sequence conflict | 441 | 1 | L → I in BAC38780. Ref.3 | ||||||
| Sequence conflict | 831 | 1 | T → A in BAC32838. Ref.3 | ||||||
| Sequence conflict | 1049 | 1 | P → S in BAC65546. Ref.2 | ||||||
| Sequence conflict | 1180 | 1 | T → A in AAP46293. Ref.1 | ||||||
| Sequence conflict | 1180 | 1 | T → A in BAC65546. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A 60kb genomic deletion is associated with non-syndromic deafness and sperm motility disorder but not with congenital dyserythropoietic anemia type I." Avidan N., Dgany O.D., Cattan D.C., Pariente A., Thulliez M., Borot N., Moati L., Alain B., Krasnov T., Olender T., Shalmon L., Ben-Asher E., Khen M., Shalev H., Fellous M., Delaunay J., Yaniv I., Zaizov R. Tamary H.Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: Swiss Webster. Tissue: Brain. |
| [2] | "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H. DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6). Strain: C57BL/6J. Tissue: Adipose tissue, Hippocampus and Olfactory bulb. |
| [4] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: C57BL/6J. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Strain: C57BL/6. Tissue: Eye. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF502585 mRNA. Translation: AAP46293.1. AK122264 mRNA. Translation: BAC65546.1. Different initiation. AK046696 mRNA. Translation: BAC32838.1. Sequence problems. AK078268 mRNA. Translation: BAC37198.1. Frameshift. AK083140 mRNA. Translation: BAC38780.1. AL845466 Genomic DNA. Translation: CAM24220.1. AL845466 Genomic DNA. Translation: CAM24221.1. AL845466 Genomic DNA. Translation: CAM24222.1. BC065138 mRNA. Translation: AAH65138.1. |
| IPI | IPI00330220. IPI00624662. IPI00750816. IPI00751331. IPI00880404. IPI00974812. |
| RefSeq | NP_848910.3. NM_178795.4. |
| UniGene | Mm.386076. |
3D structure databases | |
| ProteinModelPortal | A2ARP1. |
| SMR | A2ARP1. Positions 54-371. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | A2ARP1. |
Proteomic databases | |
| PaxDb | A2ARP1. |
| PRIDE | A2ARP1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000052029; ENSMUSP00000057632; ENSMUSG00000033526. ENSMUST00000110625; ENSMUSP00000106255; ENSMUSG00000033526. ENSMUST00000110626; ENSMUSP00000106256; ENSMUSG00000033526. ENSMUST00000110627; ENSMUSP00000106257; ENSMUSG00000033526. ENSMUST00000110628; ENSMUSP00000106258; ENSMUSG00000033526. |
| GeneID | 327655. |
| KEGG | mmu:327655. |
| UCSC | uc008lyl.1. mouse. uc008lyq.1. mouse. uc008lyr.1. mouse. uc008lys.1. mouse. |
Organism-specific databases | |
| CTD | 9677. |
| MGI | MGI:2443281. Ppip5k1. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | NOG245915. |
| GeneTree | ENSGT00390000009048. |
| HOVERGEN | HBG108657. |
| InParanoid | A2ARP1. |
| KO | K13024. |
| OMA | DSMHSNQ. |
| OrthoDB | EOG41VK25. |
Gene expression databases | |
| ArrayExpress | A2ARP1. |
| Bgee | A2ARP1. |
| CleanEx | MM_HISPPD2A. |
| Genevestigator | A2ARP1. |
Family and domain databases | |
| InterPro | IPR000560. His_Pase_superF_clade-2. [Graphical view] |
| Pfam | PF00328. His_Phos_2. 1 hit. [Graphical view] |
| PROSITE | PS00616. HIS_ACID_PHOSPHAT_1. 1 hit. PS00778. HIS_ACID_PHOSPHAT_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 397922. |
| SOURCE | Search... |
Entry information
| Entry name | VIP1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: A2ARP1 Secondary accession number(s): A2ARP2 Q8BVG9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
