SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A2ARP1

- VIP1_MOUSE

UniProt

A2ARP1 - VIP1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1
Gene
Ppip5k1, Hisppd2a, Kiaa0377, Vip1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Bifunctional inositol kinase that acts in concert with the IP6K kinases IP6K1, IP6K2 and IP6K3 to synthesize the diphosphate group-containing inositol pyrophosphates diphosphoinositol pentakisphosphate, PP-InsP5, and bis-diphosphoinositol tetrakisphosphate, (PP)2-InsP4. PP-InsP5 and (PP)2-InsP4, also respectively called InsP7 and InsP8, regulate a variety of cellular processes, including apoptosis, vesicle trafficking, cytoskeletal dynamics, exocytosis, insulin signaling and neutrophil activation. Phosphorylates inositol hexakisphosphate (InsP6) at positions 1 or 3 to produce PP-InsP5 which is in turn phosphorylated by IP6Ks to produce (PP)2-InsP4. Alternatively, phosphorylates at position 1 or 3 PP-InsP5, produced by IP6Ks from InsP6, to produce (PP)2-InsP4. Activated when cells are exposed to hyperosmotic stress By similarity.

Catalytic activityi

ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate.
ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.
ATP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.
ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei145 – 1451ATP By similarity
Binding sitei198 – 1981ATP By similarity
Binding sitei205 – 2051ATP By similarity
Binding sitei224 – 2241ATP By similarity
Binding sitei259 – 2591Substrate By similarity
Binding sitei273 – 2731Substrate By similarity
Binding sitei275 – 2751ATP By similarity
Binding sitei320 – 3201ATP By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi248 – 2514ATP By similarity
Nucleotide bindingi257 – 2593ATP By similarity
Nucleotide bindingi332 – 3343ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. acid phosphatase activity Source: InterPro
  3. diphosphoinositol-pentakisphosphate kinase activity Source: UniProtKB
  4. inositol hexakisphosphate 1-kinase activity Source: UniProtKB-EC
  5. inositol hexakisphosphate 3-kinase activity Source: UniProtKB-EC
  6. inositol hexakisphosphate 5-kinase activity Source: UniProtKB
  7. inositol-1,3,4,5,6-pentakisphosphate kinase activity Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. inositol metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_196482. Synthesis of pyrophosphates in the cytosol.

Names & Taxonomyi

Protein namesi
Recommended name:
Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 (EC:2.7.4.21, EC:2.7.4.24)
Alternative name(s):
Diphosphoinositol pentakisphosphate kinase 1
Histidine acid phosphatase domain-containing protein 2A
InsP6 and PP-IP5 kinase 1
VIP1 homolog
Gene namesi
Name:Ppip5k1
Synonyms:Hisppd2a, Kiaa0377, Vip1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:2443281. Ppip5k1.

Subcellular locationi

Cytoplasmcytosol By similarity. Cell membrane By similarity
Note: Relocalizes to the plasma membrane upon activation of the PtdIns 3-kinase pathway By similarity.

GO - Cellular componenti

  1. cytosol Source: UniProtKB
  2. nucleus Source: Ensembl
  3. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14361436Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1
PRO_0000315689Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1147 – 11471Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiA2ARP1.
PRIDEiA2ARP1.

PTM databases

PhosphoSiteiA2ARP1.

Expressioni

Gene expression databases

ArrayExpressiA2ARP1.
BgeeiA2ARP1.
CleanExiMM_HISPPD2A.
GenevestigatoriA2ARP1.

Structurei

3D structure databases

ProteinModelPortaliA2ARP1.
SMRiA2ARP1. Positions 54-371.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni64 – 652Substrate binding By similarity
Regioni224 – 2252Substrate binding By similarity
Regioni337 – 3404Substrate binding By similarity
Regioni382 – 45372Polyphosphoinositide-binding domain By similarity
Add
BLAST

Domaini

The polyphosphoinositide-binding domain mediates binding of PtdIns(3,4,5)P3 and InsP6. Despite its similarity with the phosphatase domain of histidine acid phosphatases, it has no phosphatase activity By similarity.

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG245915.
GeneTreeiENSGT00390000009048.
HOVERGENiHBG108657.
InParanoidiA2ARP1.
KOiK13024.
OMAiEEVSQPC.
OrthoDBiEOG77M8MT.
PhylomeDBiA2ARP1.
TreeFamiTF313594.

Family and domain databases

Gene3Di3.40.50.1240. 3 hits.
InterProiIPR000560. His_Pase_superF_clade-2.
IPR029033. His_PPase_superfam.
[Graphical view]
PfamiPF00328. His_Phos_2. 1 hit.
[Graphical view]
SUPFAMiSSF53254. SSF53254. 3 hits.
PROSITEiPS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A2ARP1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MWSLTANEDE STTAHFFLGA GDEGLGTCGI GMRTEESDSE LLEDEEDEVP     50
PEPQIIVGIC AMTKKSKSKP MTQILERLCR FDYLTVVILG EDVILNEPVE 100
NWPSCHCLIS FHSKGFPLDK AVAYSKLRNP FLINDLAMQY YIQDRREVYR 150
ILQEEGIDLP RYAVLNRDPA CPEECSLIEG EDQVEVNGAV FPKPFVEKPV 200
SAEDHNVYIY YPSSAGGGSQ RLFRKIGSRS SVYSPESSVR KTGSYIYEEF 250
MPTDGTDVKV YTVGPDYAHA EARKSPALDG KVERDSEGKE VRYPVMLTAM 300
EKLVARKVCV AFKQTVCGFD LLRANGHSFV CDVNGFSFVK NSMKYYDDCA 350
KILGNTIMRE LAPQFQIPWS IPTEAEDIPI VPTTSGTMME LRCVIAIIRH 400
GDRTPKQKMK MEVTHPRFFA LFEKHGGYKT GKLKLKRPEQ LQEVLDITRL 450
LLAELEKEPE AEIEEKTGKL EQLKSVLEMY GHFSGINRKV QLTYYPHGVK 500
ASNEGQDLQR EPLAPSLLLV LKWGGELTPD GRVQAEELGR AFRCMYPGGQ 550
GDYAGFPGCG LLRLHSTFRH DLKIYASDEG RVQMTAAAFA KGLLALEGEL 600
TPILVQMVKS ANMNGLLDSD SDSLSSCQHR VKARLHHILQ QDAPFGPEDY 650
DQLAPTGSTS LLNSMSVIQN PVKVCDQVFA LIENLTHQIR ERMQDPSSVD 700
LQLYHSETLE LMLQRWSKLE RDFRQKSGRY DISKIPDIYD CVKYDVQHNG 750
SLGLQGTAEL LRLSKALADV VIPQEYGISR EEKVEIAVGF CLPLLRKILL 800
DLQRTHEDES VNKLHPLYSR GVLSPGRHVR TRLYFTSESH VHSLLSVFRY 850
GGLLDETQDA QWQRALAYLS AISELNYMTQ IVIMLYEDNT RDPLSEERFH 900
VELHFSPGVK GVEEGSAPAG CGFRPASSEN EEMKTDPGSI ENLCPGKASD 950
EPDRALQTSP QPVEGTGLPR RSPLIRNRKA GSMEVLSETS SSRPGGYRLF 1000
SSSRPPTEMK QSGLGSQCTG LFSTTVLGGS SSAPNLQDYA RTHGKKLPPA 1050
SLKHRDELLF VPAVKRFSVS FAKHPTNGFE GCSMVPTIYP LETLHNALSL 1100
RQVSEFLTKV CQRHTDAHAQ ASAALFDSMH NHQASDSPFS PPRTLHSPPL 1150
QLRHRSEKPP WYSSGPSSTV SSAGPSSPTT VDGNSHFGFS DQSSVNIHMT 1200
EEKQGFGLLQ ETPGDGTREL HIERQQELVE PAQSPQELPV EICPSGSQGV 1250
TKVSQTCQEV PDIVQPCHNI HEEIGQPQQE VPDISQLLLK DHDTTTNTCH 1300
LCQASQLSQK VCEEICQLCQ DNHEESNQLC QEVSVKLGRM VHGFPVNVDS 1350
TAQETLMEIG RPTQEIPEDP YQEFSVKVGV LAQKAPAISE LSQDIPEADK 1400
PSQELSEETE LQAQEVSEEI DQESEVVDEL PPEAIS 1436
Length:1,436
Mass (Da):159,923
Last modified:February 20, 2007 - v1
Checksum:iD160DDDA7F34B4F2
GO
Isoform 2 (identifier: A2ARP1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     818-837: Missing.

Note: No experimental confirmation available.

Show »
Length:1,416
Mass (Da):157,588
Checksum:i39D0CF8B9C48BF98
GO
Isoform 3 (identifier: A2ARP1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1057-1077: Missing.

Note: No experimental confirmation available.

Show »
Length:1,415
Mass (Da):157,553
Checksum:iF51E050A638DA33A
GO
Isoform 4 (identifier: A2ARP1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-266: YTVGPD → MVDAEI
     267-1436: Missing.

Note: No experimental confirmation available.

Show »
Length:266
Mass (Da):29,888
Checksum:i3058794BBECC2253
GO
Isoform 5 (identifier: A2ARP1-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     403-439: RTPKQKMKMEVTHPRFFALFEKHGGYKTGKLKLKRPE → HPSFVIEKLVPWRCCLKLHLQDLVATVCFHLHGHQQR
     440-1436: Missing.

Note: No experimental confirmation available.

Show »
Length:439
Mass (Da):49,416
Checksum:i5886DD464B506F60
GO
Isoform 6 (identifier: A2ARP1-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     653-671: LAPTGSTSLLNSMSVIQNP → VTLFSSPCSNYIATQFLKF
     672-1436: Missing.

Note: No experimental confirmation available.

Show »
Length:671
Mass (Da):75,262
Checksum:iDDF3D544D053FE04
GO

Sequence cautioni

The sequence BAC32838.1 differs from that shown. Reason: Intron retention.
The sequence BAC37198.1 differs from that shown. Reason: Frameshift at position 42.
The sequence BAC65546.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei261 – 2666YTVGPD → MVDAEI in isoform 4.
VSP_030625
Alternative sequencei267 – 14361170Missing in isoform 4.
VSP_030626Add
BLAST
Alternative sequencei403 – 43937RTPKQ…LKRPE → HPSFVIEKLVPWRCCLKLHL QDLVATVCFHLHGHQQR in isoform 5.
VSP_030627Add
BLAST
Alternative sequencei440 – 1436997Missing in isoform 5.
VSP_030628Add
BLAST
Alternative sequencei653 – 67119LAPTG…VIQNP → VTLFSSPCSNYIATQFLKF in isoform 6.
VSP_030629Add
BLAST
Alternative sequencei672 – 1436765Missing in isoform 6.
VSP_030630Add
BLAST
Alternative sequencei818 – 83720Missing in isoform 2.
VSP_030631Add
BLAST
Alternative sequencei1057 – 107721Missing in isoform 3.
VSP_030634Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti441 – 4411L → I in BAC38780. 1 Publication
Sequence conflicti831 – 8311T → A in BAC32838. 1 Publication
Sequence conflicti1049 – 10491P → S in BAC65546. 1 Publication
Sequence conflicti1180 – 11801T → A in AAP46293. 1 Publication
Sequence conflicti1180 – 11801T → A in BAC65546. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF502585 mRNA. Translation: AAP46293.1.
AK122264 mRNA. Translation: BAC65546.1. Different initiation.
AK046696 mRNA. Translation: BAC32838.1. Sequence problems.
AK078268 mRNA. Translation: BAC37198.1. Frameshift.
AK083140 mRNA. Translation: BAC38780.1.
AL845466 Genomic DNA. Translation: CAM24220.1.
AL845466 Genomic DNA. Translation: CAM24221.1.
AL845466 Genomic DNA. Translation: CAM24222.1.
BC065138 mRNA. Translation: AAH65138.1.
CCDSiCCDS16639.1. [A2ARP1-1]
RefSeqiNP_848910.3. NM_178795.4. [A2ARP1-1]
XP_006499804.1. XM_006499741.1. [A2ARP1-1]
UniGeneiMm.386076.

Genome annotation databases

EnsembliENSMUST00000052029; ENSMUSP00000057632; ENSMUSG00000033526. [A2ARP1-1]
ENSMUST00000110625; ENSMUSP00000106255; ENSMUSG00000033526. [A2ARP1-3]
ENSMUST00000110626; ENSMUSP00000106256; ENSMUSG00000033526. [A2ARP1-1]
ENSMUST00000110627; ENSMUSP00000106257; ENSMUSG00000033526. [A2ARP1-3]
ENSMUST00000110628; ENSMUSP00000106258; ENSMUSG00000033526. [A2ARP1-2]
GeneIDi327655.
KEGGimmu:327655.
UCSCiuc008lyl.1. mouse. [A2ARP1-1]
uc008lyq.1. mouse. [A2ARP1-7]
uc008lyr.1. mouse. [A2ARP1-5]
uc008lys.1. mouse. [A2ARP1-6]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF502585 mRNA. Translation: AAP46293.1 .
AK122264 mRNA. Translation: BAC65546.1 . Different initiation.
AK046696 mRNA. Translation: BAC32838.1 . Sequence problems.
AK078268 mRNA. Translation: BAC37198.1 . Frameshift.
AK083140 mRNA. Translation: BAC38780.1 .
AL845466 Genomic DNA. Translation: CAM24220.1 .
AL845466 Genomic DNA. Translation: CAM24221.1 .
AL845466 Genomic DNA. Translation: CAM24222.1 .
BC065138 mRNA. Translation: AAH65138.1 .
CCDSi CCDS16639.1. [A2ARP1-1 ]
RefSeqi NP_848910.3. NM_178795.4. [A2ARP1-1 ]
XP_006499804.1. XM_006499741.1. [A2ARP1-1 ]
UniGenei Mm.386076.

3D structure databases

ProteinModelPortali A2ARP1.
SMRi A2ARP1. Positions 54-371.
ModBasei Search...

PTM databases

PhosphoSitei A2ARP1.

Proteomic databases

PaxDbi A2ARP1.
PRIDEi A2ARP1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000052029 ; ENSMUSP00000057632 ; ENSMUSG00000033526 . [A2ARP1-1 ]
ENSMUST00000110625 ; ENSMUSP00000106255 ; ENSMUSG00000033526 . [A2ARP1-3 ]
ENSMUST00000110626 ; ENSMUSP00000106256 ; ENSMUSG00000033526 . [A2ARP1-1 ]
ENSMUST00000110627 ; ENSMUSP00000106257 ; ENSMUSG00000033526 . [A2ARP1-3 ]
ENSMUST00000110628 ; ENSMUSP00000106258 ; ENSMUSG00000033526 . [A2ARP1-2 ]
GeneIDi 327655.
KEGGi mmu:327655.
UCSCi uc008lyl.1. mouse. [A2ARP1-1 ]
uc008lyq.1. mouse. [A2ARP1-7 ]
uc008lyr.1. mouse. [A2ARP1-5 ]
uc008lys.1. mouse. [A2ARP1-6 ]

Organism-specific databases

CTDi 9677.
MGIi MGI:2443281. Ppip5k1.
Rougei Search...

Phylogenomic databases

eggNOGi NOG245915.
GeneTreei ENSGT00390000009048.
HOVERGENi HBG108657.
InParanoidi A2ARP1.
KOi K13024.
OMAi EEVSQPC.
OrthoDBi EOG77M8MT.
PhylomeDBi A2ARP1.
TreeFami TF313594.

Enzyme and pathway databases

Reactomei REACT_196482. Synthesis of pyrophosphates in the cytosol.

Miscellaneous databases

NextBioi 397922.
PROi A2ARP1.
SOURCEi Search...

Gene expression databases

ArrayExpressi A2ARP1.
Bgeei A2ARP1.
CleanExi MM_HISPPD2A.
Genevestigatori A2ARP1.

Family and domain databases

Gene3Di 3.40.50.1240. 3 hits.
InterProi IPR000560. His_Pase_superF_clade-2.
IPR029033. His_PPase_superfam.
[Graphical view ]
Pfami PF00328. His_Phos_2. 1 hit.
[Graphical view ]
SUPFAMi SSF53254. SSF53254. 3 hits.
PROSITEi PS00616. HIS_ACID_PHOSPHAT_1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A 60kb genomic deletion is associated with non-syndromic deafness and sperm motility disorder but not with congenital dyserythropoietic anemia type I."
    Avidan N., Dgany O.D., Cattan D.C., Pariente A., Thulliez M., Borot N., Moati L., Alain B., Krasnov T., Olender T., Shalmon L., Ben-Asher E., Khen M., Shalev H., Fellous M., Delaunay J., Yaniv I., Zaizov R.
    , Beckmann J.S., Lancet D., Tamary H.
    Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Swiss Webster.
    Tissue: Brain.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6).
    Strain: C57BL/6J.
    Tissue: Adipose tissue, Hippocampus and Olfactory bulb.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: C57BL/6J.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Strain: C57BL/6.
    Tissue: Eye.

Entry informationi

Entry nameiVIP1_MOUSE
AccessioniPrimary (citable) accession number: A2ARP1
Secondary accession number(s): A2ARP2
, A2ARP3, A2ARP4, Q6P1C8, Q7TSP1, Q80U21, Q8BL16, Q8BUN6, Q8BVG9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: February 20, 2007
Last modified: September 3, 2014
This is version 74 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi