Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low-density lipoprotein receptor class A domain-containing protein 3

Gene

Ldlrad3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May influence APP processing, resulting in a decrease in sAPP-alpha production and increased amyloidogenic P3 peptide production.1 Publication

GO - Molecular functioni

  • beta-amyloid binding Source: MGI

GO - Biological processi

  • receptor-mediated endocytosis Source: MGI
  • regulation of protein processing Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Low-density lipoprotein receptor class A domain-containing protein 3
Gene namesi
Name:Ldlrad3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:2138856. Ldlrad3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini18 – 173156ExtracellularSequence analysisAdd
BLAST
Transmembranei174 – 19421HelicalSequence analysisAdd
BLAST
Topological domaini195 – 345151CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • cell junction Source: MGI
  • integral component of membrane Source: UniProtKB-KW
  • membrane Source: MGI
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1717Sequence analysisAdd
BLAST
Chaini18 – 345328Low-density lipoprotein receptor class A domain-containing protein 3PRO_0000299379Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi24 – 241N-linked (GlcNAc...)Sequence analysis
Disulfide bondi29 ↔ 42PROSITE-ProRule annotation
Disulfide bondi37 ↔ 55PROSITE-ProRule annotation
Disulfide bondi49 ↔ 64PROSITE-ProRule annotation
Disulfide bondi71 ↔ 84PROSITE-ProRule annotation
Disulfide bondi78 ↔ 97PROSITE-ProRule annotation
Disulfide bondi91 ↔ 106PROSITE-ProRule annotation
Disulfide bondi113 ↔ 125PROSITE-ProRule annotation
Disulfide bondi120 ↔ 138PROSITE-ProRule annotation
Disulfide bondi132 ↔ 147PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein

Proteomic databases

PaxDbiA2AR95.
PRIDEiA2AR95.

Expressioni

Tissue specificityi

Expressed in the cerebral cortex and hippocampus.1 Publication

Gene expression databases

BgeeiA2AR95.
ExpressionAtlasiA2AR95. baseline and differential.
GenevisibleiA2AR95. MM.

Interactioni

Subunit structurei

Interacts with APP precursor C-terminus.1 Publication

Protein-protein interaction databases

BioGridi232327. 1 interaction.
STRINGi10090.ENSMUSP00000054134.

Structurei

3D structure databases

ProteinModelPortaliA2AR95.
SMRiA2AR95. Positions 35-147.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini28 – 6538LDL-receptor class A 1PROSITE-ProRule annotationAdd
BLAST
Domaini70 – 10738LDL-receptor class A 2PROSITE-ProRule annotationAdd
BLAST
Domaini112 – 14837LDL-receptor class A 3PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi274 – 2774Poly-Pro

Sequence similaritiesi

Belongs to the LDLR family.Curated
Contains 3 LDL-receptor class A domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IPSZ. Eukaryota.
ENOG410XSZY. LUCA.
GeneTreeiENSGT00810000125405.
HOGENOMiHOG000060138.
HOVERGENiHBG108097.
InParanoidiA2AR95.
OMAiSFLCNGQ.
OrthoDBiEOG7M98GK.
PhylomeDBiA2AR95.
TreeFamiTF332096.

Family and domain databases

Gene3Di4.10.400.10. 3 hits.
InterProiIPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
[Graphical view]
PfamiPF00057. Ldl_recept_a. 3 hits.
[Graphical view]
PRINTSiPR00261. LDLRECEPTOR.
SMARTiSM00192. LDLa. 3 hits.
[Graphical view]
SUPFAMiSSF57424. SSF57424. 3 hits.
PROSITEiPS01209. LDLRA_1. 3 hits.
PS50068. LDLRA_2. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A2AR95-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWLLGPLCLL LSSTAESQLL PGNNFTNECN IPGNFMCSNG RCIPGAWQCD
60 70 80 90 100
GLPDCFDKSD EKECPKAKSK CGPTFFPCAS GIHCIIGRFR CNGFEDCPDG
110 120 130 140 150
SDEENCTANP LLCSTARYHC RNGLCIDKSF ICDGQNNCQD NSDEESCESS
160 170 180 190 200
LEPGSGQVFV TSENQLVYYP SITYAIIGSS VIFVLVVALL ALVLHHQRKR
210 220 230 240 250
NNLMTLPVHR LQHPVLLSRL VVLDHPHHCN VTYNVNNGVQ YVATQAEQNA
260 270 280 290 300
SEVGSPPSYS EALLDQRPAW YDLPPPPYSS DTESLNQADL PPYRSRSGSA
310 320 330 340
YSASSQAASS LLSVEASSHN PEQPGSPEGS AEPRDSVPSQ GTEEV
Length:345
Mass (Da):37,467
Last modified:February 20, 2007 - v1
Checksum:iE3EEE9F188DC5209
GO
Isoform 2 (identifier: A2AR95-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     305-345: SQAASSLLSVEASSHNPEQPGSPEGSAEPRDSVPSQGTEEV → LPRSQQPPECGSQQPQPRAAWLSRGLC

Show »
Length:331
Mass (Da):36,322
Checksum:i61AEE315565DF341
GO
Isoform 3 (identifier: A2AR95-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-65: GNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECP → A

Show »
Length:313
Mass (Da):33,932
Checksum:iE060249D841BB462
GO

Sequence cautioni

The sequence BAC27759.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei33 – 6533GNFMC…EKECP → A in isoform 3. CuratedVSP_027619Add
BLAST
Alternative sequencei305 – 34541SQAAS…GTEEV → LPRSQQPPECGSQQPQPRAA WLSRGLC in isoform 2. 1 PublicationVSP_027620Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029683 mRNA. Translation: BAC26562.1.
AK032208 mRNA. Translation: BAC27759.1. Different initiation.
BX571894, AL845300, BX322585 Genomic DNA. Translation: CAM17409.1.
BX322585, AL845300, BX571894 Genomic DNA. Translation: CAM19752.1.
AL845300, BX322585, BX571894 Genomic DNA. Translation: CAM23214.1.
BX571894, AL845300, BX322585 Genomic DNA. Translation: CAM17408.1.
BX322585, AL845300, BX571894 Genomic DNA. Translation: CAM19751.1.
AL845300, BX322585, BX571894 Genomic DNA. Translation: CAM23213.1.
CCDSiCCDS38187.1. [A2AR95-1]
RefSeqiNP_001277713.1. NM_001290784.1.
NP_849217.2. NM_178886.3. [A2AR95-1]
XP_006499544.1. XM_006499481.2. [A2AR95-3]
UniGeneiMm.489740.

Genome annotation databases

EnsembliENSMUST00000058790; ENSMUSP00000054134; ENSMUSG00000048058. [A2AR95-1]
ENSMUST00000111222; ENSMUSP00000106853; ENSMUSG00000048058. [A2AR95-3]
GeneIDi241576.
KEGGimmu:241576.
UCSCiuc008lhr.2. mouse. [A2AR95-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029683 mRNA. Translation: BAC26562.1.
AK032208 mRNA. Translation: BAC27759.1. Different initiation.
BX571894, AL845300, BX322585 Genomic DNA. Translation: CAM17409.1.
BX322585, AL845300, BX571894 Genomic DNA. Translation: CAM19752.1.
AL845300, BX322585, BX571894 Genomic DNA. Translation: CAM23214.1.
BX571894, AL845300, BX322585 Genomic DNA. Translation: CAM17408.1.
BX322585, AL845300, BX571894 Genomic DNA. Translation: CAM19751.1.
AL845300, BX322585, BX571894 Genomic DNA. Translation: CAM23213.1.
CCDSiCCDS38187.1. [A2AR95-1]
RefSeqiNP_001277713.1. NM_001290784.1.
NP_849217.2. NM_178886.3. [A2AR95-1]
XP_006499544.1. XM_006499481.2. [A2AR95-3]
UniGeneiMm.489740.

3D structure databases

ProteinModelPortaliA2AR95.
SMRiA2AR95. Positions 35-147.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi232327. 1 interaction.
STRINGi10090.ENSMUSP00000054134.

Proteomic databases

PaxDbiA2AR95.
PRIDEiA2AR95.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000058790; ENSMUSP00000054134; ENSMUSG00000048058. [A2AR95-1]
ENSMUST00000111222; ENSMUSP00000106853; ENSMUSG00000048058. [A2AR95-3]
GeneIDi241576.
KEGGimmu:241576.
UCSCiuc008lhr.2. mouse. [A2AR95-1]

Organism-specific databases

CTDi143458.
MGIiMGI:2138856. Ldlrad3.

Phylogenomic databases

eggNOGiENOG410IPSZ. Eukaryota.
ENOG410XSZY. LUCA.
GeneTreeiENSGT00810000125405.
HOGENOMiHOG000060138.
HOVERGENiHBG108097.
InParanoidiA2AR95.
OMAiSFLCNGQ.
OrthoDBiEOG7M98GK.
PhylomeDBiA2AR95.
TreeFamiTF332096.

Miscellaneous databases

ChiTaRSiLdlrad3. mouse.
PROiA2AR95.
SOURCEiSearch...

Gene expression databases

BgeeiA2AR95.
ExpressionAtlasiA2AR95. baseline and differential.
GenevisibleiA2AR95. MM.

Family and domain databases

Gene3Di4.10.400.10. 3 hits.
InterProiIPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
[Graphical view]
PfamiPF00057. Ldl_recept_a. 3 hits.
[Graphical view]
PRINTSiPR00261. LDLRECEPTOR.
SMARTiSM00192. LDLa. 3 hits.
[Graphical view]
SUPFAMiSSF57424. SSF57424. 3 hits.
PROSITEiPS01209. LDLRA_1. 3 hits.
PS50068. LDLRA_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Olfactory bulb and Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 3).
    Strain: C57BL/6J.
  3. "LRAD3, a novel low-density lipoprotein receptor family member that modulates amyloid precursor protein trafficking."
    Ranganathan S., Noyes N.C., Migliorini M., Winkles J.A., Battey F.D., Hyman B.T., Smith E., Yepes M., Mikhailenko I., Strickland D.K.
    J. Neurosci. 31:10836-10846(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH APP, TISSUE SPECIFICITY.

Entry informationi

Entry nameiLRAD3_MOUSE
AccessioniPrimary (citable) accession number: A2AR95
Secondary accession number(s): A2AR96, Q8CCS0, Q8CDR7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: February 20, 2007
Last modified: June 8, 2016
This is version 80 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.