Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Formin-like protein 2

Gene

Fmnl2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-5663220. RHO GTPases Activate Formins.

Names & Taxonomyi

Protein namesi
Recommended name:
Formin-like protein 2
Alternative name(s):
Protein Man
Gene namesi
Name:Fmnl2
Synonyms:Kiaa1902, Man
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1918659. Fmnl2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00002890942 – 1086Formin-like protein 2Add BLAST1085

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycineBy similarity1
Modified residuei188PhosphoserineBy similarity1

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

MaxQBiA2APV2.
PaxDbiA2APV2.
PeptideAtlasiA2APV2.
PRIDEiA2APV2.

PTM databases

iPTMnetiA2APV2.
PhosphoSitePlusiA2APV2.
SwissPalmiA2APV2.

Expressioni

Gene expression databases

BgeeiENSMUSG00000036053.
CleanExiMM_FMNL2.
ExpressionAtlasiA2APV2. baseline and differential.
GenevisibleiA2APV2. MM.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

IntActiA2APV2. 1 interactor.
STRINGi10090.ENSMUSP00000047260.

Structurei

3D structure databases

ProteinModelPortaliA2APV2.
SMRiA2APV2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini23 – 469GBD/FH3PROSITE-ProRule annotationAdd BLAST447
Domaini615 – 1006FH2PROSITE-ProRule annotationAdd BLAST392
Domaini1038 – 1077DADAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi525 – 602Pro-richAdd BLAST78

Domaini

The DAD domain regulates activation via by an autoinhibitory interaction with the GBD/FH3 domain. This autoinhibition is released upon competitive binding of an activated GTPase. The release of DAD allows the FH2 domain to then nucleate and elongate nonbranched actin filaments (By similarity).By similarity

Sequence similaritiesi

Belongs to the formin homology family.Curated
Contains 1 FH2 (formin homology 2) domain.PROSITE-ProRule annotation
Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1923. Eukaryota.
ENOG410Y3DT. LUCA.
GeneTreeiENSGT00760000118986.
HOGENOMiHOG000231209.
HOVERGENiHBG053118.
InParanoidiA2APV2.
OMAiTENEAMA.
OrthoDBiEOG091G01GP.
PhylomeDBiA2APV2.
TreeFamiTF325155.

Family and domain databases

InterProiIPR016024. ARM-type_fold.
IPR015425. FH2_Formin.
IPR010472. FH3_dom.
IPR027656. FMNL2.
IPR014768. GBD/FH3_dom.
IPR010473. GTPase-bd.
[Graphical view]
PANTHERiPTHR23213:SF180. PTHR23213:SF180. 1 hit.
PfamiPF06367. Drf_FH3. 1 hit.
PF06371. Drf_GBD. 2 hits.
PF02181. FH2. 1 hit.
[Graphical view]
SMARTiSM01139. Drf_FH3. 1 hit.
SM01140. Drf_GBD. 1 hit.
SM00498. FH2. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.
PROSITEiPS51444. FH2. 1 hit.
PS51232. GBD_FH3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A2APV2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNAGSMDSQ QTDFKAHNVP LKLPMPEPGE LEERFAIVLN AMNLPPDKAR
60 70 80 90 100
LLRQYDNEKK WELICDQERF QVKNPPHTYI QKLKGYLDPA VTRKKFRRRV
110 120 130 140 150
QESTQVLREL EISLRTNHIG WVREFLNEEN KGLDVLVEYL SFAQYAVTFD
160 170 180 190 200
FESVESTMES TVDKSKPWSR SIEDLHRGSN LPSPVGNSVS RSGRHSALRY
210 220 230 240 250
NTLPSRRTLK NSRLVSKKDD VHVCIMCLRA IMNYQYGFNM VMSHPHAVNE
260 270 280 290 300
IALSLNNKNP RTKALVLELL AAVCLVRGGH EIILSAFDNF KEVCGEKQRF
310 320 330 340 350
EKLMEHFRNE DNNIDFMVAS MQFINIVVHS VEDMNFRVHL QYEFTKLGLD
360 370 380 390 400
EYLDKLKHTE SDKLQVQIQA YLDNVFDVGA LLEDAETKNA ALERVEELEE
410 420 430 440 450
NISHLSEKLQ DTENEAMSKI VELEKQLMQR NKELDVVREI YKDANTQVHT
460 470 480 490 500
LRKMVKEKEE AIQRQSTLEK KIHELEKQGT IKIQKKGDGD IAILPVMASG
510 520 530 540 550
TLSTGSELAV GNYVGSVPGA TTSGPSVPPP PPLPPSSDTS EAAQNGTASP
560 570 580 590 600
PMSPPPPPPP PPPPPPPPPP PLPGPAAETS PAPPLPPPPP PSAPPLPGTS
610 620 630 640 650
SPTVVFNSGL AAVKIKKPIK TKFRMPVFNW VALKPNQING TVFNEIDDER
660 670 680 690 700
ILEDLNVDEF EEIFKTKAQG PAIDLSSSKQ KITQKASSKV TLLEANRAKN
710 720 730 740 750
LAITLRKAGK SADEICKAIH VFDLKTLPVD FVECLMRFLP TENEVKVLRL
760 770 780 790 800
YERERKPLEN LSDEDRFMMQ FSKIERLLQK MTIMAFIGNF TESIQMLTPQ
810 820 830 840 850
LHAIIAASVS IKSSQKLKKI LEIILALGNY MNSSKRGAVY GFKLQSLDLL
860 870 880 890 900
LDTKSTDRKQ TLLHYISNVV KEKYQQVTLF YNELHYVEKA AAVSLENVLL
910 920 930 940 950
DVKELQRGMD LTKREYTMHD HNTLLKEFLL HNEGKLKKLQ EDAKIAQDAF
960 970 980 990 1000
DDVVKYFGEN PKTTPPSVFF PVFVRFVKAY KQAEEENELR KKQEQALMEK
1010 1020 1030 1040 1050
LLEQEALMEQ QDAKSPSHKS KRQQQELIAE LRRRQVKDNR HVYEGKDGAI
1060 1070 1080
EDIITALKKN NITKFPNVHS RVRISSSTPV VEDTQS
Length:1,086
Mass (Da):123,101
Last modified:May 29, 2007 - v2
Checksum:i0E5BBC192FCF8ACA
GO
Isoform 2 (identifier: A2APV2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     554-588: Missing.
     1056-1067: ALKKNNITKFPN → VLETNPTDEPMR
     1068-1086: Missing.

Note: No experimental confirmation available.
Show »
Length:1,032
Mass (Da):117,710
Checksum:i0FF576DB4E3D08D8
GO
Isoform 3 (identifier: A2APV2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1056-1086: ALKKNNITKFPNVHSRVRISSSTPVVEDTQS → DLRNQPYRRADAVRRSVRRRFDDQNLRSVNGAEITM

Note: No experimental confirmation available.
Show »
Length:1,091
Mass (Da):123,980
Checksum:i628270CEE84078F1
GO

Sequence cautioni

The sequence AAP87551 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAM19613 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti557 – 591Missing in AAP87551 (Ref. 2) CuratedAdd BLAST35

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_025888554 – 588Missing in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0258891056 – 1086ALKKN…EDTQS → DLRNQPYRRADAVRRSVRRR FDDQNLRSVNGAEITM in isoform 3. CuratedAdd BLAST31
Alternative sequenceiVSP_0258901056 – 1067ALKKN…TKFPN → VLETNPTDEPMR in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_0258911068 – 1086Missing in isoform 2. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL844859, AL844510, AL845170 Genomic DNA. Translation: CAM19034.1.
AL845170, AL844510, AL844859 Genomic DNA. Translation: CAM19616.1.
AL844510, AL844859, AL845170 Genomic DNA. Translation: CAM25963.1.
AL845170 Genomic DNA. Translation: CAM19613.1. Sequence problems.
AF513716 mRNA. Translation: AAP87551.1. Different initiation.
BC048004 mRNA. Translation: AAH48004.1.
AK173293 mRNA. Translation: BAD32571.1.
RefSeqiNP_765997.2. NM_172409.2.
XP_006498396.1. XM_006498333.3. [A2APV2-3]
UniGeneiMm.394427.

Genome annotation databases

EnsembliENSMUST00000090952; ENSMUSP00000088472; ENSMUSG00000036053. [A2APV2-3]
GeneIDi71409.
KEGGimmu:71409.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL844859, AL844510, AL845170 Genomic DNA. Translation: CAM19034.1.
AL845170, AL844510, AL844859 Genomic DNA. Translation: CAM19616.1.
AL844510, AL844859, AL845170 Genomic DNA. Translation: CAM25963.1.
AL845170 Genomic DNA. Translation: CAM19613.1. Sequence problems.
AF513716 mRNA. Translation: AAP87551.1. Different initiation.
BC048004 mRNA. Translation: AAH48004.1.
AK173293 mRNA. Translation: BAD32571.1.
RefSeqiNP_765997.2. NM_172409.2.
XP_006498396.1. XM_006498333.3. [A2APV2-3]
UniGeneiMm.394427.

3D structure databases

ProteinModelPortaliA2APV2.
SMRiA2APV2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiA2APV2. 1 interactor.
STRINGi10090.ENSMUSP00000047260.

PTM databases

iPTMnetiA2APV2.
PhosphoSitePlusiA2APV2.
SwissPalmiA2APV2.

Proteomic databases

MaxQBiA2APV2.
PaxDbiA2APV2.
PeptideAtlasiA2APV2.
PRIDEiA2APV2.

Protocols and materials databases

DNASUi71409.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000090952; ENSMUSP00000088472; ENSMUSG00000036053. [A2APV2-3]
GeneIDi71409.
KEGGimmu:71409.

Organism-specific databases

CTDi114793.
MGIiMGI:1918659. Fmnl2.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1923. Eukaryota.
ENOG410Y3DT. LUCA.
GeneTreeiENSGT00760000118986.
HOGENOMiHOG000231209.
HOVERGENiHBG053118.
InParanoidiA2APV2.
OMAiTENEAMA.
OrthoDBiEOG091G01GP.
PhylomeDBiA2APV2.
TreeFamiTF325155.

Enzyme and pathway databases

ReactomeiR-MMU-5663220. RHO GTPases Activate Formins.

Miscellaneous databases

ChiTaRSiFmnl2. mouse.
PROiA2APV2.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000036053.
CleanExiMM_FMNL2.
ExpressionAtlasiA2APV2. baseline and differential.
GenevisibleiA2APV2. MM.

Family and domain databases

InterProiIPR016024. ARM-type_fold.
IPR015425. FH2_Formin.
IPR010472. FH3_dom.
IPR027656. FMNL2.
IPR014768. GBD/FH3_dom.
IPR010473. GTPase-bd.
[Graphical view]
PANTHERiPTHR23213:SF180. PTHR23213:SF180. 1 hit.
PfamiPF06367. Drf_FH3. 1 hit.
PF06371. Drf_GBD. 2 hits.
PF02181. FH2. 1 hit.
[Graphical view]
SMARTiSM01139. Drf_FH3. 1 hit.
SM01140. Drf_GBD. 1 hit.
SM00498. FH2. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.
PROSITEiPS51444. FH2. 1 hit.
PS51232. GBD_FH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFMNL2_MOUSE
AccessioniPrimary (citable) accession number: A2APV2
Secondary accession number(s): A2AQW1
, Q69Z73, Q7TPA8, Q80VH6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: November 2, 2016
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.