Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rap1 GTPase-activating protein 1

Gene

Rap1gap

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Enzyme and pathway databases

ReactomeiR-MMU-392517. Rap1 signalling.

Names & Taxonomyi

Protein namesi
Recommended name:
Rap1 GTPase-activating protein 1
Short name:
Rap1GAP
Short name:
Rap1GAP1
Alternative name(s):
ARPP-90
Gene namesi
Name:Rap1gap
Synonyms:Kiaa0474, Rap1ga1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:109338. Rap1gap.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 663663Rap1 GTPase-activating protein 1PRO_0000424956Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei441 – 4411PhosphoserineCombined sources
Modified residuei484 – 4841PhosphoserineCombined sources
Modified residuei499 – 4991PhosphoserineCombined sources1 Publication
Modified residuei541 – 5411PhosphoserineCombined sources
Modified residuei542 – 5421PhosphoserineCombined sources
Isoform 2 (identifier: A2ALS5-2)
Modified residuei7 – 71PhosphoserineCombined sources
Modified residuei9 – 91PhosphothreonineCombined sources
Isoform 3 (identifier: A2ALS5-3)
Modified residuei17 – 171PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiA2ALS5.
PaxDbiA2ALS5.
PRIDEiA2ALS5.

PTM databases

iPTMnetiA2ALS5.

Expressioni

Tissue specificityi

Detected in brain cortex and striatum (at protein level). Detected in brain cortex and striatum.1 Publication

Gene expression databases

ExpressionAtlasiA2ALS5. baseline and differential.
GenevisibleiA2ALS5. MM.

Interactioni

Subunit structurei

Homodimer and heterodimer with RAP1B.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi225521. 2 interactions.
IntActiA2ALS5. 3 interactions.
MINTiMINT-4117429.
STRINGi10090.ENSMUSP00000101461.

Structurei

3D structure databases

ProteinModelPortaliA2ALS5.
SMRiA2ALS5. Positions 78-414.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 1717GoLocoPROSITE-ProRule annotationAdd
BLAST
Domaini181 – 397217Rap-GAPPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi421 – 4266Poly-Gly
Compositional biasi566 – 5749Poly-Ser

Sequence similaritiesi

Contains 1 GoLoco domain.PROSITE-ProRule annotation
Contains 1 Rap-GAP domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3686. Eukaryota.
ENOG410XTIX. LUCA.
GeneTreeiENSGT00760000119182.
HOGENOMiHOG000231640.
HOVERGENiHBG016371.
KOiK17700.

Family and domain databases

InterProiIPR003109. GoLoco_motif.
IPR000331. Rap_GAP_dom.
[Graphical view]
PfamiPF02188. GoLoco. 1 hit.
PF02145. Rap_GAP. 1 hit.
[Graphical view]
SMARTiSM00390. GoLoco. 1 hit.
[Graphical view]
SUPFAMiSSF111347. SSF111347. 1 hit.
PROSITEiPS50877. GOLOCO. 1 hit.
PS50085. RAPGAP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A2ALS5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIEKMQGSRM DEQRCSFPPP LKTEEDYIPY PSVHEVLGRE GPFPLILLPQ
60 70 80 90 100
FGGYWIEGTN HEISSLPETE PLQSPTTKVK LECNPTARIY RKHFLGKEHF
110 120 130 140 150
NYYSLDTALG HLVFSLKYDV IGDQEHLRLL LRTKCRTHHD VIPISCLTEF
160 170 180 190 200
PNVVQMAKLV CEDVNVDRFY PVLYPKASRL IVTFDEHVIS NNFKFGVIYQ
210 220 230 240 250
KLGQTSEEEL FSTNEESPAF VEFLEFLGQK VKLQDFKGFR GGLDVTHGQT
260 270 280 290 300
GTESVYCNFR NKEIMFHVST KLPYTEGDAQ QLQRKRHIGN DIVAVVFQDE
310 320 330 340 350
NTPFVPDMIA SNFLHAYVVV QAEGGGPDGP LYKVSVTARD DVPFFGPPLP
360 370 380 390 400
DPAVFRKGPE FQEFLLTKLI NAEYACYKAE KFAKLEERTR AALLETLYEE
410 420 430 440 450
LHIHSQSMMG LGGDDDKMEN GSGGGGFFES FKRVIRSRSQ SMDAMGLSNK
460 470 480 490 500
KPNTVSTSHS GSFTPNNPDL AKAAGISLIV PGKSPTRKKS GPFGSRRSSA
510 520 530 540 550
IGIENIQEVQ EKRESPPAGQ KTPDSGHVSQ EPKSENSSTQ SSPEMPTTKN
560 570 580 590 600
RVESAAQRTE VLQGFSRSSS SASSFTSVVE ETEGVDGDDT GLESVSSSGT
610 620 630 640 650
PHKRDSFLYS TWLDDSVSTT SGGSSPGLTR SPHPDVGKSG DPACPEIKIQ
660
LETSEQHTPQ MGC
Length:663
Mass (Da):73,433
Last modified:January 22, 2014 - v2
Checksum:iE3C8B54957C30C71
GO
Isoform 2 (identifier: A2ALS5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGRKRSFTFGAYGGVDKSFSLRQSVWRSDGQKQSFPQALNLLLVDSVPSHPASPYPKNTDLFEM

Show »
Length:727
Mass (Da):80,550
Checksum:i8E2EFFF49901369C
GO
Isoform 3 (identifier: A2ALS5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAQPRPPAPHGRPRRGSLPAGAGWQNTDLFEM

Show »
Length:694
Mass (Da):76,784
Checksum:iB4B5ED75448DB722
GO
Isoform 4 (identifier: A2ALS5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-663: ESVSSSGTPH...SEQHTPQMGC → HMAGRQREHH...ASCHLISRRD

Note: No experimental confirmation available.
Show »
Length:665
Mass (Da):74,135
Checksum:iE72034E66B4E58DE
GO

Sequence cautioni

The sequence AAH52065.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD32233.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti413 – 4131G → S in BAD32233 (PubMed:15368895).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSGRKRSFTFGAYGGVDKSF SLRQSVWRSDGQKQSFPQAL NLLLVDSVPSHPASPYPKNT DLFEM in isoform 2. CuratedVSP_053560
Alternative sequencei1 – 11M → MAQPRPPAPHGRPRRGSLPA GAGWQNTDLFEM in isoform 3. CuratedVSP_053561
Alternative sequencei593 – 66371ESVSS…PQMGC → HMAGRQREHHERGQLPSEVA PSCPPSQASHGHPTQTSASR GTLRVPRSRSNWKHLSSTHP RWAASCHLISRRD in isoform 4. 1 PublicationVSP_053562Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK172955 mRNA. Translation: BAD32233.1. Different initiation.
AL805954 Genomic DNA. No translation available.
BC030891 mRNA. Translation: AAH30891.1.
BC052065 mRNA. Translation: AAH52065.1. Different initiation.
CCDSiCCDS38925.1. [A2ALS5-2]
RefSeqiNP_001074624.1. NM_001081155.2. [A2ALS5-2]
NP_001243147.1. NM_001256218.1.
NP_083839.1. NM_029563.1. [A2ALS5-1]
XP_006538544.1. XM_006538481.1. [A2ALS5-3]
UniGeneiMm.180763.

Genome annotation databases

EnsembliENSMUST00000047243; ENSMUSP00000042473; ENSMUSG00000041351. [A2ALS5-2]
ENSMUST00000097837; ENSMUSP00000095448; ENSMUSG00000041351. [A2ALS5-3]
GeneIDi110351.
KEGGimmu:110351.
UCSCiuc008vjm.2. mouse. [A2ALS5-1]
uc008vjn.2. mouse. [A2ALS5-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK172955 mRNA. Translation: BAD32233.1. Different initiation.
AL805954 Genomic DNA. No translation available.
BC030891 mRNA. Translation: AAH30891.1.
BC052065 mRNA. Translation: AAH52065.1. Different initiation.
CCDSiCCDS38925.1. [A2ALS5-2]
RefSeqiNP_001074624.1. NM_001081155.2. [A2ALS5-2]
NP_001243147.1. NM_001256218.1.
NP_083839.1. NM_029563.1. [A2ALS5-1]
XP_006538544.1. XM_006538481.1. [A2ALS5-3]
UniGeneiMm.180763.

3D structure databases

ProteinModelPortaliA2ALS5.
SMRiA2ALS5. Positions 78-414.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi225521. 2 interactions.
IntActiA2ALS5. 3 interactions.
MINTiMINT-4117429.
STRINGi10090.ENSMUSP00000101461.

PTM databases

iPTMnetiA2ALS5.

Proteomic databases

MaxQBiA2ALS5.
PaxDbiA2ALS5.
PRIDEiA2ALS5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000047243; ENSMUSP00000042473; ENSMUSG00000041351. [A2ALS5-2]
ENSMUST00000097837; ENSMUSP00000095448; ENSMUSG00000041351. [A2ALS5-3]
GeneIDi110351.
KEGGimmu:110351.
UCSCiuc008vjm.2. mouse. [A2ALS5-1]
uc008vjn.2. mouse. [A2ALS5-2]

Organism-specific databases

CTDi5909.
MGIiMGI:109338. Rap1gap.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3686. Eukaryota.
ENOG410XTIX. LUCA.
GeneTreeiENSGT00760000119182.
HOGENOMiHOG000231640.
HOVERGENiHBG016371.
KOiK17700.

Enzyme and pathway databases

ReactomeiR-MMU-392517. Rap1 signalling.

Miscellaneous databases

PROiA2ALS5.
SOURCEiSearch...

Gene expression databases

ExpressionAtlasiA2ALS5. baseline and differential.
GenevisibleiA2ALS5. MM.

Family and domain databases

InterProiIPR003109. GoLoco_motif.
IPR000331. Rap_GAP_dom.
[Graphical view]
PfamiPF02188. GoLoco. 1 hit.
PF02145. Rap_GAP. 1 hit.
[Graphical view]
SMARTiSM00390. GoLoco. 1 hit.
[Graphical view]
SUPFAMiSSF111347. SSF111347. 1 hit.
PROSITEiPS50877. GOLOCO. 1 hit.
PS50085. RAPGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H.
    DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 241-663 (ISOFORM 1).
    Strain: C57BL/6J and FVB/N.
    Tissue: Brain and Mammary tumor.
  4. "Phosphorylation of Rap1GAP, a striatally enriched protein, by protein kinase A controls Rap1 activity and dendritic spine morphology."
    McAvoy T., Zhou M.M., Greengard P., Nairn A.C.
    Proc. Natl. Acad. Sci. U.S.A. 106:3531-3536(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, PHOSPHORYLATION AT SER-499.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441; SER-484; SER-499; SER-541 AND SER-542, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-7 AND THR-9 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-17 (ISOFORM 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Kidney, Lung, Pancreas and Spleen.

Entry informationi

Entry nameiRPGP1_MOUSE
AccessioniPrimary (citable) accession number: A2ALS5
Secondary accession number(s): E9PZZ8
, Q6A063, Q80VZ8, Q8K2L6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 22, 2014
Last sequence update: January 22, 2014
Last modified: June 8, 2016
This is version 68 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.