Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rap1 GTPase-activating protein 1

Gene

Rap1gap

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

ReactomeiR-MMU-392517 Rap1 signalling
R-MMU-8853659 RET signaling

Names & Taxonomyi

Protein namesi
Recommended name:
Rap1 GTPase-activating protein 1
Short name:
Rap1GAP
Short name:
Rap1GAP1
Alternative name(s):
ARPP-90
Gene namesi
Name:Rap1gap
Synonyms:Kiaa0474, Rap1ga1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:109338 Rap1gap

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004249561 – 663Rap1 GTPase-activating protein 1Add BLAST663

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei441PhosphoserineCombined sources1
Modified residuei484PhosphoserineCombined sources1
Modified residuei499PhosphoserineCombined sources1 Publication1
Modified residuei515PhosphoserineBy similarity1
Modified residuei541PhosphoserineCombined sources1
Modified residuei542PhosphoserineCombined sources1
Isoform 2 (identifier: A2ALS5-2)
Modified residuei7PhosphoserineCombined sources1
Modified residuei9PhosphothreonineCombined sources1
Isoform 3 (identifier: A2ALS5-3)
Modified residuei17PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiA2ALS5
PaxDbiA2ALS5
PeptideAtlasiA2ALS5
PRIDEiA2ALS5

PTM databases

iPTMnetiA2ALS5
PhosphoSitePlusiA2ALS5

Expressioni

Tissue specificityi

Detected in brain cortex and striatum (at protein level). Detected in brain cortex and striatum.1 Publication

Gene expression databases

BgeeiENSMUSG00000041351
ExpressionAtlasiA2ALS5 baseline and differential
GenevisibleiA2ALS5 MM

Interactioni

Subunit structurei

Homodimer and heterodimer with RAP1B.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi225521, 2 interactors
IntActiA2ALS5, 3 interactors
MINTiA2ALS5
STRINGi10090.ENSMUSP00000101461

Structurei

3D structure databases

ProteinModelPortaliA2ALS5
SMRiA2ALS5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 17GoLocoPROSITE-ProRule annotationAdd BLAST17
Domaini181 – 397Rap-GAPPROSITE-ProRule annotationAdd BLAST217

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi421 – 426Poly-Gly6
Compositional biasi566 – 574Poly-Ser9

Phylogenomic databases

eggNOGiKOG3686 Eukaryota
ENOG410XTIX LUCA
GeneTreeiENSGT00760000119182
HOGENOMiHOG000231640
HOVERGENiHBG016371
KOiK17700

Family and domain databases

Gene3Di3.40.50.11210, 1 hit
InterProiView protein in InterPro
IPR003109 GoLoco_motif
IPR035974 Rap/Ran-GAP_sf
IPR000331 Rap_GAP_dom
PfamiView protein in Pfam
PF02188 GoLoco, 1 hit
PF02145 Rap_GAP, 1 hit
SMARTiView protein in SMART
SM00390 GoLoco, 1 hit
SUPFAMiSSF111347 SSF111347, 1 hit
PROSITEiView protein in PROSITE
PS50877 GOLOCO, 1 hit
PS50085 RAPGAP, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A2ALS5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIEKMQGSRM DEQRCSFPPP LKTEEDYIPY PSVHEVLGRE GPFPLILLPQ
60 70 80 90 100
FGGYWIEGTN HEISSLPETE PLQSPTTKVK LECNPTARIY RKHFLGKEHF
110 120 130 140 150
NYYSLDTALG HLVFSLKYDV IGDQEHLRLL LRTKCRTHHD VIPISCLTEF
160 170 180 190 200
PNVVQMAKLV CEDVNVDRFY PVLYPKASRL IVTFDEHVIS NNFKFGVIYQ
210 220 230 240 250
KLGQTSEEEL FSTNEESPAF VEFLEFLGQK VKLQDFKGFR GGLDVTHGQT
260 270 280 290 300
GTESVYCNFR NKEIMFHVST KLPYTEGDAQ QLQRKRHIGN DIVAVVFQDE
310 320 330 340 350
NTPFVPDMIA SNFLHAYVVV QAEGGGPDGP LYKVSVTARD DVPFFGPPLP
360 370 380 390 400
DPAVFRKGPE FQEFLLTKLI NAEYACYKAE KFAKLEERTR AALLETLYEE
410 420 430 440 450
LHIHSQSMMG LGGDDDKMEN GSGGGGFFES FKRVIRSRSQ SMDAMGLSNK
460 470 480 490 500
KPNTVSTSHS GSFTPNNPDL AKAAGISLIV PGKSPTRKKS GPFGSRRSSA
510 520 530 540 550
IGIENIQEVQ EKRESPPAGQ KTPDSGHVSQ EPKSENSSTQ SSPEMPTTKN
560 570 580 590 600
RVESAAQRTE VLQGFSRSSS SASSFTSVVE ETEGVDGDDT GLESVSSSGT
610 620 630 640 650
PHKRDSFLYS TWLDDSVSTT SGGSSPGLTR SPHPDVGKSG DPACPEIKIQ
660
LETSEQHTPQ MGC
Length:663
Mass (Da):73,433
Last modified:January 22, 2014 - v2
Checksum:iE3C8B54957C30C71
GO
Isoform 2 (identifier: A2ALS5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGRKRSFTFGAYGGVDKSFSLRQSVWRSDGQKQSFPQALNLLLVDSVPSHPASPYPKNTDLFEM

Show »
Length:727
Mass (Da):80,550
Checksum:i8E2EFFF49901369C
GO
Isoform 3 (identifier: A2ALS5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAQPRPPAPHGRPRRGSLPAGAGWQNTDLFEM

Show »
Length:694
Mass (Da):76,784
Checksum:iB4B5ED75448DB722
GO
Isoform 4 (identifier: A2ALS5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-663: ESVSSSGTPH...SEQHTPQMGC → HMAGRQREHH...ASCHLISRRD

Note: No experimental confirmation available.
Show »
Length:665
Mass (Da):74,135
Checksum:iE72034E66B4E58DE
GO

Sequence cautioni

The sequence AAH52065 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD32233 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti413G → S in BAD32233 (PubMed:15368895).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0535601M → MSGRKRSFTFGAYGGVDKSF SLRQSVWRSDGQKQSFPQAL NLLLVDSVPSHPASPYPKNT DLFEM in isoform 2. Curated1
Alternative sequenceiVSP_0535611M → MAQPRPPAPHGRPRRGSLPA GAGWQNTDLFEM in isoform 3. Curated1
Alternative sequenceiVSP_053562593 – 663ESVSS…PQMGC → HMAGRQREHHERGQLPSEVA PSCPPSQASHGHPTQTSASR GTLRVPRSRSNWKHLSSTHP RWAASCHLISRRD in isoform 4. 1 PublicationAdd BLAST71

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK172955 mRNA Translation: BAD32233.1 Different initiation.
AL805954 Genomic DNA No translation available.
BC030891 mRNA Translation: AAH30891.1
BC052065 mRNA Translation: AAH52065.1 Different initiation.
CCDSiCCDS38925.1 [A2ALS5-2]
CCDS84809.1 [A2ALS5-3]
RefSeqiNP_001074624.1, NM_001081155.3 [A2ALS5-2]
NP_001318144.1, NM_001331215.1 [A2ALS5-3]
NP_083839.1, NM_029563.2 [A2ALS5-1]
UniGeneiMm.180763

Genome annotation databases

EnsembliENSMUST00000047243; ENSMUSP00000042473; ENSMUSG00000041351 [A2ALS5-2]
ENSMUST00000097837; ENSMUSP00000095448; ENSMUSG00000041351 [A2ALS5-3]
GeneIDi110351
KEGGimmu:110351
UCSCiuc008vjm.2 mouse [A2ALS5-1]
uc008vjn.2 mouse [A2ALS5-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRPGP1_MOUSE
AccessioniPrimary (citable) accession number: A2ALS5
Secondary accession number(s): E9PZZ8
, Q6A063, Q80VZ8, Q8K2L6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 22, 2014
Last sequence update: January 22, 2014
Last modified: March 28, 2018
This is version 78 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health