Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NADPH-dependent diflavin oxidoreductase 1

Gene

Ndor1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery. Required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis. Transfers electrons from NADPH to the Fe/S cluster of CIAPIN1.UniRule annotation

Cofactori

Protein has several cofactor binding sites:
  • FADUniRule annotation
  • FMNUniRule annotation

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei132 – 1321FMNUniRule annotation
Binding sitei350 – 3501FADUniRule annotation
Binding sitei461 – 4611NADPUniRule annotation
Binding sitei559 – 5591NADPUniRule annotation
Binding sitei597 – 5971FADUniRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi12 – 176FMNUniRule annotation
Nucleotide bindingi59 – 624FMNUniRule annotation
Nucleotide bindingi97 – 10610FMNUniRule annotation
Nucleotide bindingi382 – 3854FADUniRule annotation
Nucleotide bindingi416 – 4194FADUniRule annotation
Nucleotide bindingi516 – 5172NADPUniRule annotation
Nucleotide bindingi522 – 5265NADPUniRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Ligandi

FAD, Flavoprotein, FMN, NADP

Names & Taxonomyi

Protein namesi
Recommended name:
NADPH-dependent diflavin oxidoreductase 1UniRule annotation (EC:1.18.1.-UniRule annotation)
Alternative name(s):
NADPH-dependent FMN and FAD-containing oxidoreductaseUniRule annotation
Gene namesi
Name:Ndor1UniRule annotation
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1926047. Ndor1.

Subcellular locationi

  • Cytoplasmperinuclear region UniRule annotation

  • Note: Concentrated in perinuclear structure.UniRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 598598NADPH-dependent diflavin oxidoreductase 1PRO_0000319540Add
BLAST

Proteomic databases

EPDiA2AI05.
MaxQBiA2AI05.
PaxDbiA2AI05.
PRIDEiA2AI05.

PTM databases

iPTMnetiA2AI05.
PhosphoSiteiA2AI05.

Expressioni

Gene expression databases

BgeeiA2AI05.
CleanExiMM_NDOR1.
ExpressionAtlasiA2AI05. baseline and differential.
GenevisibleiA2AI05. MM.

Interactioni

Subunit structurei

Interacts with CIAPIN1. Interacts with DCPS.UniRule annotation

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000109989.

Structurei

3D structure databases

ProteinModelPortaliA2AI05.
SMRiA2AI05. Positions 4-598.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini6 – 150145Flavodoxin-likeUniRule annotationAdd
BLAST
Domaini206 – 448243FAD-binding FR-typeUniRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the NADPH-dependent diflavin oxidoreductase NDOR1 family.UniRule annotation
In the N-terminal section; belongs to the flavodoxin family.UniRule annotation
In the C-terminal section; belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.UniRule annotation
Contains 1 FAD-binding FR-type domain.UniRule annotation
Contains 1 flavodoxin-like domain.UniRule annotation

Phylogenomic databases

eggNOGiKOG1159. Eukaryota.
COG0369. LUCA.
GeneTreeiENSGT00840000129757.
HOGENOMiHOG000173033.
HOVERGENiHBG104950.
InParanoidiA2AI05.
OMAiAIPPDYL.
OrthoDBiEOG7QG44B.
PhylomeDBiA2AI05.
TreeFamiTF105716.

Family and domain databases

Gene3Di1.20.990.10. 1 hit.
3.40.50.360. 1 hit.
HAMAPiMF_03178. NDOR1.
InterProiIPR003097. FAD-binding_1.
IPR017927. Fd_Rdtase_FAD-bd.
IPR001094. Flavdoxin-like.
IPR008254. Flavodoxin/NO_synth.
IPR001709. Flavoprot_Pyr_Nucl_cyt_Rdtase.
IPR029039. Flavoprotein-like_dom.
IPR023173. NADPH_Cyt_P450_Rdtase_dom3.
IPR028879. NDOR1.
IPR001433. OxRdtase_FAD/NAD-bd.
IPR017938. Riboflavin_synthase-like_b-brl.
[Graphical view]
PfamiPF00667. FAD_binding_1. 1 hit.
PF00258. Flavodoxin_1. 1 hit.
PF00175. NAD_binding_1. 1 hit.
[Graphical view]
PRINTSiPR00369. FLAVODOXIN.
PR00371. FPNCR.
SUPFAMiSSF52218. SSF52218. 1 hit.
SSF63380. SSF63380. 1 hit.
PROSITEiPS51384. FAD_FR. 1 hit.
PS50902. FLAVODOXIN_LIKE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A2AI05-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQVPQLLVLF GSQTGTAQDE AERLGREARR RRLGCRVQAL DSYSVANLIR
60 70 80 90 100
EPLVIFVCAT TGQGDPPDNM KNFWRFIFRK SLPSSSLCQM DFAVLGLGDS
110 120 130 140 150
SYAKFNFVAK KLHRRLLQLG GSALLPPCLG DDQHELGPDA AIDPWVGDLW
160 170 180 190 200
EKIMVMYPVP LDIPEIPHGV PLPSKFIFQF LQEVPSIGAE ELNIASSAPQ
210 220 230 240 250
TPPSELQPFL APVITNQRVT GPQHFQDVRL IEFDITDSNI SFAAGDVVFI
260 270 280 290 300
LPSNSEAHTQ QFCQVLCLDP NQFFTLKPRE PGVPDPPGLP QPCTVWNLVS
310 320 330 340 350
QYLDIASVPR RSFFELLACL SQHALEREKL LELSSARGQE ELWEYCSRPR
360 370 380 390 400
RTILEVLCDF PHTAGAIPPD YLLDLIPRIR PRAFSIASSL LAHPRRLQIL
410 420 430 440 450
VAVVKYQTRL KEPRHGLCSS WLASLNPGQA GPVRVPLWVR PGSLVFPKTP
460 470 480 490 500
DTPIIMVGAG TGVAPFRAAI QERVAHGQTG NFLFFGCRQR DQDFYWQTEW
510 520 530 540 550
QKLEQKGWLT LVTAFSREQE QKVYVQHRLR ELGPLVWELL DGQGAYFYLA
560 570 580 590
GNAKYLPTDV SEALMSIFQE EGRLSTADAS AYLARLQQTL RFQTETWA
Note: Gene prediction based on EST data.
Length:598
Mass (Da):67,183
Last modified:February 20, 2007 - v1
Checksum:i7B621663EEE85FED
GO
Isoform 2 (identifier: A2AI05-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-171: KFNFVAKKLHRRLLQLGGSALLPPCLGDDQHELGPDAAIDPWVGDLWEKIMVMYPVPLDIPEIPHGVP → N

Show »
Length:531
Mass (Da):59,749
Checksum:i973A680C3DB10F46
GO
Isoform 3 (identifier: A2AI05-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MQVPQLLVLFGSQTGTAQDEAERLGREARRRRLGCRVQALDSYSV → MRCREGTDQGCQRPYIYLCLVLE
     481-488: NFLFFGCR → EYWSSKAV
     489-598: Missing.

Show »
Length:466
Mass (Da):51,869
Checksum:i4AC0553432F989B3
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4545MQVPQ…DSYSV → MRCREGTDQGCQRPYIYLCL VLE in isoform 3. 1 PublicationVSP_031488Add
BLAST
Alternative sequencei104 – 17168KFNFV…PHGVP → N in isoform 2. 2 PublicationsVSP_031489Add
BLAST
Alternative sequencei481 – 4888NFLFFGCR → EYWSSKAV in isoform 3. 1 PublicationVSP_031490
Alternative sequencei489 – 598110Missing in isoform 3. 1 PublicationVSP_031491Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK163207 mRNA. Translation: BAE37235.1.
AK169885 mRNA. Translation: BAE41435.1.
AL732309 Genomic DNA. Translation: CAM14675.1.
BC049789 mRNA. Translation: AAH49789.1.
CCDSiCCDS38069.1. [A2AI05-1]
CCDS57157.1. [A2AI05-2]
RefSeqiNP_001075945.1. NM_001082476.2. [A2AI05-1]
NP_001239470.1. NM_001252541.1. [A2AI05-2]
UniGeneiMm.40020.

Genome annotation databases

EnsembliENSMUST00000100329; ENSMUSP00000097903; ENSMUSG00000006471. [A2AI05-2]
ENSMUST00000114349; ENSMUSP00000109989; ENSMUSG00000006471. [A2AI05-1]
GeneIDi78797.
KEGGimmu:78797.
UCSCiuc008iqw.2. mouse. [A2AI05-1]
uc012brw.2. mouse. [A2AI05-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK163207 mRNA. Translation: BAE37235.1.
AK169885 mRNA. Translation: BAE41435.1.
AL732309 Genomic DNA. Translation: CAM14675.1.
BC049789 mRNA. Translation: AAH49789.1.
CCDSiCCDS38069.1. [A2AI05-1]
CCDS57157.1. [A2AI05-2]
RefSeqiNP_001075945.1. NM_001082476.2. [A2AI05-1]
NP_001239470.1. NM_001252541.1. [A2AI05-2]
UniGeneiMm.40020.

3D structure databases

ProteinModelPortaliA2AI05.
SMRiA2AI05. Positions 4-598.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000109989.

PTM databases

iPTMnetiA2AI05.
PhosphoSiteiA2AI05.

Proteomic databases

EPDiA2AI05.
MaxQBiA2AI05.
PaxDbiA2AI05.
PRIDEiA2AI05.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000100329; ENSMUSP00000097903; ENSMUSG00000006471. [A2AI05-2]
ENSMUST00000114349; ENSMUSP00000109989; ENSMUSG00000006471. [A2AI05-1]
GeneIDi78797.
KEGGimmu:78797.
UCSCiuc008iqw.2. mouse. [A2AI05-1]
uc012brw.2. mouse. [A2AI05-2]

Organism-specific databases

CTDi27158.
MGIiMGI:1926047. Ndor1.

Phylogenomic databases

eggNOGiKOG1159. Eukaryota.
COG0369. LUCA.
GeneTreeiENSGT00840000129757.
HOGENOMiHOG000173033.
HOVERGENiHBG104950.
InParanoidiA2AI05.
OMAiAIPPDYL.
OrthoDBiEOG7QG44B.
PhylomeDBiA2AI05.
TreeFamiTF105716.

Miscellaneous databases

NextBioi349532.
PROiA2AI05.
SOURCEiSearch...

Gene expression databases

BgeeiA2AI05.
CleanExiMM_NDOR1.
ExpressionAtlasiA2AI05. baseline and differential.
GenevisibleiA2AI05. MM.

Family and domain databases

Gene3Di1.20.990.10. 1 hit.
3.40.50.360. 1 hit.
HAMAPiMF_03178. NDOR1.
InterProiIPR003097. FAD-binding_1.
IPR017927. Fd_Rdtase_FAD-bd.
IPR001094. Flavdoxin-like.
IPR008254. Flavodoxin/NO_synth.
IPR001709. Flavoprot_Pyr_Nucl_cyt_Rdtase.
IPR029039. Flavoprotein-like_dom.
IPR023173. NADPH_Cyt_P450_Rdtase_dom3.
IPR028879. NDOR1.
IPR001433. OxRdtase_FAD/NAD-bd.
IPR017938. Riboflavin_synthase-like_b-brl.
[Graphical view]
PfamiPF00667. FAD_binding_1. 1 hit.
PF00258. Flavodoxin_1. 1 hit.
PF00175. NAD_binding_1. 1 hit.
[Graphical view]
PRINTSiPR00369. FLAVODOXIN.
PR00371. FPNCR.
SUPFAMiSSF52218. SSF52218. 1 hit.
SSF63380. SSF63380. 1 hit.
PROSITEiPS51384. FAD_FR. 1 hit.
PS50902. FLAVODOXIN_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J and NOD.
    Tissue: Cerebellum and Dendritic cell.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Embryo.

Entry informationi

Entry nameiNDOR1_MOUSE
AccessioniPrimary (citable) accession number: A2AI05
Secondary accession number(s): Q3TQZ6, Q80WC5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 20, 2007
Last modified: May 11, 2016
This is version 80 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.