Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A2ABV5

- MED14_MOUSE

UniProt

A2ABV5 - MED14_MOUSE

Protein

Mediator of RNA polymerase II transcription subunit 14

Gene

Med14

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 67 (01 Oct 2014)
      Sequence version 1 (20 Feb 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors By similarity.By similarity

    GO - Molecular functioni

    1. receptor activity Source: Ensembl
    2. RNA polymerase II transcription cofactor activity Source: Ensembl
    3. transcription coactivator activity Source: Ensembl

    GO - Biological processi

    1. androgen receptor signaling pathway Source: Ensembl
    2. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    3. stem cell maintenance Source: MGI
    4. transcription initiation from RNA polymerase II promoter Source: Ensembl

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Enzyme and pathway databases

    ReactomeiREACT_198602. PPARA activates gene expression.
    REACT_206529. Generic Transcription Pathway.
    REACT_27166. Transcriptional Regulation of Adipocyte Differentiation in 3T3-L1 Pre-adipocytes.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Mediator of RNA polymerase II transcription subunit 14
    Alternative name(s):
    Cofactor required for Sp1 transcriptional activation subunit 2
    Short name:
    CRSP complex subunit 2
    Mediator complex subunit 14
    Thyroid hormone receptor-associated protein complex 170 kDa component
    Short name:
    Trap170
    Gene namesi
    Name:Med14
    Synonyms:Crsp2, Gm641, Trap170
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome X

    Organism-specific databases

    MGIiMGI:1349442. Med14.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. mediator complex Source: MGI
    2. nucleoplasm Source: Reactome

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 14591459Mediator of RNA polymerase II transcription subunit 14PRO_0000304585Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei623 – 6231PhosphoserineBy similarity
    Modified residuei992 – 9921PhosphoserineBy similarity
    Modified residuei1117 – 11171PhosphoserineBy similarity
    Modified residuei1124 – 11241PhosphoserineBy similarity
    Modified residuei1133 – 11331PhosphoserineBy similarity
    Modified residuei1141 – 11411PhosphoserineBy similarity
    Modified residuei1149 – 11491PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiA2ABV5.
    PaxDbiA2ABV5.
    PRIDEiA2ABV5.

    PTM databases

    PhosphoSiteiA2ABV5.

    Expressioni

    Gene expression databases

    ArrayExpressiA2ABV5.
    BgeeiA2ABV5.
    CleanExiMM_MED14.
    GenevestigatoriA2ABV5.

    Interactioni

    Subunit structurei

    Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. Interacts with AR, ESR1, SREBF1 and STAT2 By similarity. Interacts with GATA1.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi205047. 4 interactions.
    IntActiA2ABV5. 4 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliA2ABV5.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni194 – 572379Interaction with STAT2By similarityAdd
    BLAST
    Regioni506 – 830325Interaction with SREBF1By similarityAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi75 – 795LXXLL motif 1
    Motifi1187 – 11915LXXLL motif 2

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi31 – 5121Ala-richAdd
    BLAST
    Compositional biasi1008 – 1170163Pro-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the Mediator complex subunit 14 family.Curated

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG281210.
    GeneTreeiENSGT00390000001021.
    HOGENOMiHOG000045361.
    HOVERGENiHBG104308.
    InParanoidiA2ABV5.
    KOiK15156.
    OMAiKPLQISH.
    OrthoDBiEOG7SR4KK.
    PhylomeDBiA2ABV5.
    TreeFamiTF314388.

    Family and domain databases

    InterProiIPR013947. Mediator_Med14.
    [Graphical view]
    PfamiPF08638. Med14. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A2ABV5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAPVQLDNHQ LIPPGGGGGS SGGGGSSSGS ASAPAPPPPA AAVAAAAAAA     50
    ASPGYRLSTL IEFLLHRAYS ELMVLTDLLP RKSDVERKIE IVQFASRTRQ 100
    LFVRLLALVK WANDAGKVEK CAMISSFLDQ QAILFVDTAD RLASLARDAL 150
    VHARLPSFAI PYAIDVLTTG SYPRLPTCIR DKIIPPDPIT KIEKQATLHQ 200
    LNQILRHRLV TTDLPPQLAN LTVANGRVKF RVEGEFEATL TVMGDDPEVP 250
    WRLLKLEILV EDKETGDGRA LVHSMQIDFI HQLVQSRLFA DEKPLQDMYN 300
    CLHCFCLSLQ LEVLHSQTLM LIRERWGDLV QVERYHAGKS LSLSVWNQQV 350
    LGRKTGTASV HKVTIKIDEN DVSKPLQIFH DPPLPASDSK LVERAMKIDH 400
    LSIEKLLIDS VHARAHQRLQ ELKAILRSFN ANESSSIETA LPALIVPILE 450
    PCGNSECLHI FVDLHSGMFQ LMLYGLDPAT LEDMEKSLND DMKRIIPWIQ 500
    QLKFWLGQQR CKQSIKHLPT ITTETLQLAN YSTHPIGSLS KNKLFIKLTR 550
    LPQYYIVVEM LEVPNKPTQL SYNYYFMSVS TADREDSPVM ALLLQQFKDN 600
    IQDLMSYTKT GKQTRTGTKH KLSDDPCPID SKKAKRSGEM CAFNKVLAHF 650
    VAMCDTNMPF VGLRLELSNL EIPHQGVQVE GDGFNHAIRL LKIPPCKGIS 700
    EETQKALDRS LLDCTFRLQG RNNRTWVAEL VFANCPLNGT STREQGPSRH 750
    VYLTYENLLS EPVGGRKVVE MFLNDWSSIA RLYECVLEFA RSLPEIPAHL 800
    NIFSEVRVYN YRKLILCYGT TKGSSISIQW NSIHQKFHIA LGTVGPNSGC 850
    SNCHNTILHQ LQEMFNKTPN VVQLLQVLFD TQAPLNAINK LPTVPMLGLT 900
    QRTNTAYQCF SILPQSSTHI RLAFRNMYCI DIYCRSRGVV AIRDGAYSLF 950
    DNSKLVEGFY PAPGLKTFLN MFVDSNQDAR RRSVNEDDNP PSPIGGDMMD 1000
    SLISQLQPPQ QQPFPKQPGT SGAYPLTSPP TSYHSTVNQS PSMMHTQSPG 1050
    NLHAASSPSG ALRAPSPASF VPTPPPSSHG ISIGPGASFA SPHGTLDPSS 1100
    PYTMVSPSGR AGNWPGSPQV SGPSPATRLP GMSPANPSLH SPVPDVSHSP 1150
    RAGTSSQTMP TNMPPPRKLP QRSWAASIPT ILTHSALNIL LLPSPTPGLV 1200
    PGLAGSYLCS PLERFLGSVI MRRHLQRIIQ QETLQLINSN EPGVIMFKTD 1250
    ALKCRVALSP KTNQTLQLKV TPENAGQWKP DELQVLEKFF ETRVAGPPFK 1300
    ANTLIAFTKL LGAPTHILRD CVHIMKLELF PDQATQLKWN VQFCLTIPPS 1350
    APPIAPPGTP AVVLKSKMLF FLQLTQKTSV PPQEPVSIIV PIIYDMASGT 1400
    TQQADIPRQQ NSSVAAPMMV SNILKRFAEM NPPRQGECTI FAAVRDLMAN 1450
    LTLPPGGRP 1459
    Length:1,459
    Mass (Da):160,966
    Last modified:February 20, 2007 - v1
    Checksum:iFE61E45E8E99E4E9
    GO
    Isoform 2 (identifier: A2ABV5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         747-770: PSRHVYLTYENLLSEPVGGRKVVE → KIFHTVFLLMSIFLKVLVTISFFL
         771-1459: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:770
    Mass (Da):86,050
    Checksum:iAE645E84E4B373E2
    GO
    Isoform 3 (identifier: A2ABV5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         436-471: SIETALPALIVPILEPCGNSECLHIFVDLHSGMFQL → KHSRAGEMAQQLRVPTALPKVLSSNPINHMVAHNHL
         472-1459: Missing.

    Show »
    Length:471
    Mass (Da):51,942
    Checksum:i9E560273E9D3CC85
    GO
    Isoform 4 (identifier: A2ABV5-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-72: Missing.
         435-1459: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:362
    Mass (Da):41,127
    Checksum:i2F6672DA26CFE08C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti158 – 1581F → C in BAE37289. (PubMed:16141072)Curated
    Sequence conflicti346 – 3472WN → C in BAA76611. (PubMed:10512684)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7272Missing in isoform 4. 1 PublicationVSP_028033Add
    BLAST
    Alternative sequencei435 – 14591025Missing in isoform 4. 1 PublicationVSP_028034Add
    BLAST
    Alternative sequencei436 – 47136SIETA…GMFQL → KHSRAGEMAQQLRVPTALPK VLSSNPINHMVAHNHL in isoform 3. 1 PublicationVSP_028035Add
    BLAST
    Alternative sequencei472 – 1459988Missing in isoform 3. 1 PublicationVSP_028036Add
    BLAST
    Alternative sequencei747 – 77024PSRHV…RKVVE → KIFHTVFLLMSIFLKVLVTI SFFL in isoform 2. 1 PublicationVSP_028037Add
    BLAST
    Alternative sequencei771 – 1459689Missing in isoform 2. 1 PublicationVSP_028038Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB019028 mRNA. Translation: BAA76610.1.
    AB019029 Genomic DNA. Translation: BAA76611.1.
    AK163306 mRNA. Translation: BAE37289.1.
    AL662925, BX000537 Genomic DNA. Translation: CAM17981.1.
    BX000537, AL662925 Genomic DNA. Translation: CAM27890.1.
    BC065072 mRNA. Translation: AAH65072.1.
    CCDSiCCDS40874.1. [A2ABV5-1]
    RefSeqiNP_001041673.1. NM_001048208.1. [A2ABV5-1]
    NP_036135.3. NM_012005.3.
    UniGeneiMm.17616.

    Genome annotation databases

    EnsembliENSMUST00000096495; ENSMUSP00000094239; ENSMUSG00000064127. [A2ABV5-1]
    GeneIDi26896.
    KEGGimmu:26896.
    UCSCiuc009sqz.1. mouse. [A2ABV5-1]
    uc009srd.1. mouse. [A2ABV5-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB019028 mRNA. Translation: BAA76610.1 .
    AB019029 Genomic DNA. Translation: BAA76611.1 .
    AK163306 mRNA. Translation: BAE37289.1 .
    AL662925 , BX000537 Genomic DNA. Translation: CAM17981.1 .
    BX000537 , AL662925 Genomic DNA. Translation: CAM27890.1 .
    BC065072 mRNA. Translation: AAH65072.1 .
    CCDSi CCDS40874.1. [A2ABV5-1 ]
    RefSeqi NP_001041673.1. NM_001048208.1. [A2ABV5-1 ]
    NP_036135.3. NM_012005.3.
    UniGenei Mm.17616.

    3D structure databases

    ProteinModelPortali A2ABV5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 205047. 4 interactions.
    IntActi A2ABV5. 4 interactions.

    PTM databases

    PhosphoSitei A2ABV5.

    Proteomic databases

    MaxQBi A2ABV5.
    PaxDbi A2ABV5.
    PRIDEi A2ABV5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000096495 ; ENSMUSP00000094239 ; ENSMUSG00000064127 . [A2ABV5-1 ]
    GeneIDi 26896.
    KEGGi mmu:26896.
    UCSCi uc009sqz.1. mouse. [A2ABV5-1 ]
    uc009srd.1. mouse. [A2ABV5-3 ]

    Organism-specific databases

    CTDi 9282.
    MGIi MGI:1349442. Med14.

    Phylogenomic databases

    eggNOGi NOG281210.
    GeneTreei ENSGT00390000001021.
    HOGENOMi HOG000045361.
    HOVERGENi HBG104308.
    InParanoidi A2ABV5.
    KOi K15156.
    OMAi KPLQISH.
    OrthoDBi EOG7SR4KK.
    PhylomeDBi A2ABV5.
    TreeFami TF314388.

    Enzyme and pathway databases

    Reactomei REACT_198602. PPARA activates gene expression.
    REACT_206529. Generic Transcription Pathway.
    REACT_27166. Transcriptional Regulation of Adipocyte Differentiation in 3T3-L1 Pre-adipocytes.

    Miscellaneous databases

    NextBioi 304735.
    PROi A2ABV5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi A2ABV5.
    Bgeei A2ABV5.
    CleanExi MM_MED14.
    Genevestigatori A2ABV5.

    Family and domain databases

    InterProi IPR013947. Mediator_Med14.
    [Graphical view ]
    Pfami PF08638. Med14. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Detection and cloning of an X-linked locus associated with a NotI site that is not methylated on mouse inactivated X chromosome by the RLGS-M method."
      Takada S., Kamiya M., Arima T., Kagebayashi H., Shibata H., Muramatsu M., Chapman V.M., Wake N., Hayashizaki Y., Takagi N.
      Genomics 61:92-100(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3).
      Strain: C57BL/6J.
      Tissue: Kidney.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Strain: C57BL/6J.
      Tissue: Egg.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6.
      Tissue: Brain.
    5. "The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220."
      Stumpf M., Waskow C., Kroetschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder R.G., Borggrefe T.
      Proc. Natl. Acad. Sci. U.S.A. 103:18504-18509(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH GATA1.
    6. Erratum
      Stumpf M., Waskow C., Kroetschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder R.G., Borggrefe T.
      Proc. Natl. Acad. Sci. U.S.A. 104:1442-1442(2007)

    Entry informationi

    Entry nameiMED14_MOUSE
    AccessioniPrimary (citable) accession number: A2ABV5
    Secondary accession number(s): Q3TQU3
    , Q6P1H5, Q9R0T1, Q9WTN9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 11, 2007
    Last sequence update: February 20, 2007
    Last modified: October 1, 2014
    This is version 67 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3