Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A2ABV5

- MED14_MOUSE

UniProt

A2ABV5 - MED14_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Mediator of RNA polymerase II transcription subunit 14

Gene

Med14

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).By similarity

GO - Molecular functioni

  1. receptor activity Source: Ensembl
  2. RNA polymerase II transcription cofactor activity Source: Ensembl
  3. transcription coactivator activity Source: Ensembl

GO - Biological processi

  1. androgen receptor signaling pathway Source: Ensembl
  2. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  3. stem cell maintenance Source: MGI
  4. transcription initiation from RNA polymerase II promoter Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiREACT_198602. PPARA activates gene expression.
REACT_206529. Generic Transcription Pathway.
REACT_27166. Transcriptional Regulation of Adipocyte Differentiation in 3T3-L1 Pre-adipocytes.

Names & Taxonomyi

Protein namesi
Recommended name:
Mediator of RNA polymerase II transcription subunit 14
Alternative name(s):
Cofactor required for Sp1 transcriptional activation subunit 2
Short name:
CRSP complex subunit 2
Mediator complex subunit 14
Thyroid hormone receptor-associated protein complex 170 kDa component
Short name:
Trap170
Gene namesi
Name:Med14
Synonyms:Crsp2, Gm641, Trap170
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome X

Organism-specific databases

MGIiMGI:1349442. Med14.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. mediator complex Source: MGI
  2. nucleoplasm Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14591459Mediator of RNA polymerase II transcription subunit 14PRO_0000304585Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei623 – 6231PhosphoserineBy similarity
Modified residuei992 – 9921PhosphoserineBy similarity
Modified residuei1117 – 11171PhosphoserineBy similarity
Modified residuei1124 – 11241PhosphoserineBy similarity
Modified residuei1133 – 11331PhosphoserineBy similarity
Modified residuei1141 – 11411PhosphoserineBy similarity
Modified residuei1149 – 11491PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiA2ABV5.
PaxDbiA2ABV5.
PRIDEiA2ABV5.

PTM databases

PhosphoSiteiA2ABV5.

Expressioni

Gene expression databases

BgeeiA2ABV5.
CleanExiMM_MED14.
ExpressionAtlasiA2ABV5. baseline and differential.
GenevestigatoriA2ABV5.

Interactioni

Subunit structurei

Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. Interacts with AR, ESR1, SREBF1 and STAT2 (By similarity). Interacts with GATA1.By similarity1 Publication

Protein-protein interaction databases

BioGridi205047. 4 interactions.
IntActiA2ABV5. 4 interactions.

Structurei

3D structure databases

ProteinModelPortaliA2ABV5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni194 – 572379Interaction with STAT2By similarityAdd
BLAST
Regioni506 – 830325Interaction with SREBF1By similarityAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi75 – 795LXXLL motif 1
Motifi1187 – 11915LXXLL motif 2

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi31 – 5121Ala-richAdd
BLAST
Compositional biasi1008 – 1170163Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the Mediator complex subunit 14 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG281210.
GeneTreeiENSGT00390000001021.
HOGENOMiHOG000045361.
HOVERGENiHBG104308.
InParanoidiA2ABV5.
KOiK15156.
OMAiKPLQISH.
OrthoDBiEOG7SR4KK.
PhylomeDBiA2ABV5.
TreeFamiTF314388.

Family and domain databases

InterProiIPR013947. Mediator_Med14.
[Graphical view]
PfamiPF08638. Med14. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A2ABV5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPVQLDNHQ LIPPGGGGGS SGGGGSSSGS ASAPAPPPPA AAVAAAAAAA
60 70 80 90 100
ASPGYRLSTL IEFLLHRAYS ELMVLTDLLP RKSDVERKIE IVQFASRTRQ
110 120 130 140 150
LFVRLLALVK WANDAGKVEK CAMISSFLDQ QAILFVDTAD RLASLARDAL
160 170 180 190 200
VHARLPSFAI PYAIDVLTTG SYPRLPTCIR DKIIPPDPIT KIEKQATLHQ
210 220 230 240 250
LNQILRHRLV TTDLPPQLAN LTVANGRVKF RVEGEFEATL TVMGDDPEVP
260 270 280 290 300
WRLLKLEILV EDKETGDGRA LVHSMQIDFI HQLVQSRLFA DEKPLQDMYN
310 320 330 340 350
CLHCFCLSLQ LEVLHSQTLM LIRERWGDLV QVERYHAGKS LSLSVWNQQV
360 370 380 390 400
LGRKTGTASV HKVTIKIDEN DVSKPLQIFH DPPLPASDSK LVERAMKIDH
410 420 430 440 450
LSIEKLLIDS VHARAHQRLQ ELKAILRSFN ANESSSIETA LPALIVPILE
460 470 480 490 500
PCGNSECLHI FVDLHSGMFQ LMLYGLDPAT LEDMEKSLND DMKRIIPWIQ
510 520 530 540 550
QLKFWLGQQR CKQSIKHLPT ITTETLQLAN YSTHPIGSLS KNKLFIKLTR
560 570 580 590 600
LPQYYIVVEM LEVPNKPTQL SYNYYFMSVS TADREDSPVM ALLLQQFKDN
610 620 630 640 650
IQDLMSYTKT GKQTRTGTKH KLSDDPCPID SKKAKRSGEM CAFNKVLAHF
660 670 680 690 700
VAMCDTNMPF VGLRLELSNL EIPHQGVQVE GDGFNHAIRL LKIPPCKGIS
710 720 730 740 750
EETQKALDRS LLDCTFRLQG RNNRTWVAEL VFANCPLNGT STREQGPSRH
760 770 780 790 800
VYLTYENLLS EPVGGRKVVE MFLNDWSSIA RLYECVLEFA RSLPEIPAHL
810 820 830 840 850
NIFSEVRVYN YRKLILCYGT TKGSSISIQW NSIHQKFHIA LGTVGPNSGC
860 870 880 890 900
SNCHNTILHQ LQEMFNKTPN VVQLLQVLFD TQAPLNAINK LPTVPMLGLT
910 920 930 940 950
QRTNTAYQCF SILPQSSTHI RLAFRNMYCI DIYCRSRGVV AIRDGAYSLF
960 970 980 990 1000
DNSKLVEGFY PAPGLKTFLN MFVDSNQDAR RRSVNEDDNP PSPIGGDMMD
1010 1020 1030 1040 1050
SLISQLQPPQ QQPFPKQPGT SGAYPLTSPP TSYHSTVNQS PSMMHTQSPG
1060 1070 1080 1090 1100
NLHAASSPSG ALRAPSPASF VPTPPPSSHG ISIGPGASFA SPHGTLDPSS
1110 1120 1130 1140 1150
PYTMVSPSGR AGNWPGSPQV SGPSPATRLP GMSPANPSLH SPVPDVSHSP
1160 1170 1180 1190 1200
RAGTSSQTMP TNMPPPRKLP QRSWAASIPT ILTHSALNIL LLPSPTPGLV
1210 1220 1230 1240 1250
PGLAGSYLCS PLERFLGSVI MRRHLQRIIQ QETLQLINSN EPGVIMFKTD
1260 1270 1280 1290 1300
ALKCRVALSP KTNQTLQLKV TPENAGQWKP DELQVLEKFF ETRVAGPPFK
1310 1320 1330 1340 1350
ANTLIAFTKL LGAPTHILRD CVHIMKLELF PDQATQLKWN VQFCLTIPPS
1360 1370 1380 1390 1400
APPIAPPGTP AVVLKSKMLF FLQLTQKTSV PPQEPVSIIV PIIYDMASGT
1410 1420 1430 1440 1450
TQQADIPRQQ NSSVAAPMMV SNILKRFAEM NPPRQGECTI FAAVRDLMAN

LTLPPGGRP
Length:1,459
Mass (Da):160,966
Last modified:February 20, 2007 - v1
Checksum:iFE61E45E8E99E4E9
GO
Isoform 2 (identifier: A2ABV5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     747-770: PSRHVYLTYENLLSEPVGGRKVVE → KIFHTVFLLMSIFLKVLVTISFFL
     771-1459: Missing.

Note: No experimental confirmation available.

Show »
Length:770
Mass (Da):86,050
Checksum:iAE645E84E4B373E2
GO
Isoform 3 (identifier: A2ABV5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     436-471: SIETALPALIVPILEPCGNSECLHIFVDLHSGMFQL → KHSRAGEMAQQLRVPTALPKVLSSNPINHMVAHNHL
     472-1459: Missing.

Show »
Length:471
Mass (Da):51,942
Checksum:i9E560273E9D3CC85
GO
Isoform 4 (identifier: A2ABV5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.
     435-1459: Missing.

Note: No experimental confirmation available.

Show »
Length:362
Mass (Da):41,127
Checksum:i2F6672DA26CFE08C
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti158 – 1581F → C in BAE37289. (PubMed:16141072)Curated
Sequence conflicti346 – 3472WN → C in BAA76611. (PubMed:10512684)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7272Missing in isoform 4. 1 PublicationVSP_028033Add
BLAST
Alternative sequencei435 – 14591025Missing in isoform 4. 1 PublicationVSP_028034Add
BLAST
Alternative sequencei436 – 47136SIETA…GMFQL → KHSRAGEMAQQLRVPTALPK VLSSNPINHMVAHNHL in isoform 3. 1 PublicationVSP_028035Add
BLAST
Alternative sequencei472 – 1459988Missing in isoform 3. 1 PublicationVSP_028036Add
BLAST
Alternative sequencei747 – 77024PSRHV…RKVVE → KIFHTVFLLMSIFLKVLVTI SFFL in isoform 2. 1 PublicationVSP_028037Add
BLAST
Alternative sequencei771 – 1459689Missing in isoform 2. 1 PublicationVSP_028038Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB019028 mRNA. Translation: BAA76610.1.
AB019029 Genomic DNA. Translation: BAA76611.1.
AK163306 mRNA. Translation: BAE37289.1.
AL662925, BX000537 Genomic DNA. Translation: CAM17981.1.
BX000537, AL662925 Genomic DNA. Translation: CAM27890.1.
BC065072 mRNA. Translation: AAH65072.1.
CCDSiCCDS40874.1. [A2ABV5-1]
RefSeqiNP_001041673.1. NM_001048208.1. [A2ABV5-1]
NP_036135.3. NM_012005.3.
UniGeneiMm.17616.

Genome annotation databases

EnsembliENSMUST00000096495; ENSMUSP00000094239; ENSMUSG00000064127. [A2ABV5-1]
GeneIDi26896.
KEGGimmu:26896.
UCSCiuc009sqz.1. mouse. [A2ABV5-1]
uc009srd.1. mouse. [A2ABV5-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB019028 mRNA. Translation: BAA76610.1 .
AB019029 Genomic DNA. Translation: BAA76611.1 .
AK163306 mRNA. Translation: BAE37289.1 .
AL662925 , BX000537 Genomic DNA. Translation: CAM17981.1 .
BX000537 , AL662925 Genomic DNA. Translation: CAM27890.1 .
BC065072 mRNA. Translation: AAH65072.1 .
CCDSi CCDS40874.1. [A2ABV5-1 ]
RefSeqi NP_001041673.1. NM_001048208.1. [A2ABV5-1 ]
NP_036135.3. NM_012005.3.
UniGenei Mm.17616.

3D structure databases

ProteinModelPortali A2ABV5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 205047. 4 interactions.
IntActi A2ABV5. 4 interactions.

PTM databases

PhosphoSitei A2ABV5.

Proteomic databases

MaxQBi A2ABV5.
PaxDbi A2ABV5.
PRIDEi A2ABV5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000096495 ; ENSMUSP00000094239 ; ENSMUSG00000064127 . [A2ABV5-1 ]
GeneIDi 26896.
KEGGi mmu:26896.
UCSCi uc009sqz.1. mouse. [A2ABV5-1 ]
uc009srd.1. mouse. [A2ABV5-3 ]

Organism-specific databases

CTDi 9282.
MGIi MGI:1349442. Med14.

Phylogenomic databases

eggNOGi NOG281210.
GeneTreei ENSGT00390000001021.
HOGENOMi HOG000045361.
HOVERGENi HBG104308.
InParanoidi A2ABV5.
KOi K15156.
OMAi KPLQISH.
OrthoDBi EOG7SR4KK.
PhylomeDBi A2ABV5.
TreeFami TF314388.

Enzyme and pathway databases

Reactomei REACT_198602. PPARA activates gene expression.
REACT_206529. Generic Transcription Pathway.
REACT_27166. Transcriptional Regulation of Adipocyte Differentiation in 3T3-L1 Pre-adipocytes.

Miscellaneous databases

NextBioi 304735.
PROi A2ABV5.
SOURCEi Search...

Gene expression databases

Bgeei A2ABV5.
CleanExi MM_MED14.
ExpressionAtlasi A2ABV5. baseline and differential.
Genevestigatori A2ABV5.

Family and domain databases

InterProi IPR013947. Mediator_Med14.
[Graphical view ]
Pfami PF08638. Med14. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Detection and cloning of an X-linked locus associated with a NotI site that is not methylated on mouse inactivated X chromosome by the RLGS-M method."
    Takada S., Kamiya M., Arima T., Kagebayashi H., Shibata H., Muramatsu M., Chapman V.M., Wake N., Hayashizaki Y., Takagi N.
    Genomics 61:92-100(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Kidney.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Strain: C57BL/6J.
    Tissue: Egg.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6.
    Tissue: Brain.
  5. "The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220."
    Stumpf M., Waskow C., Kroetschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder R.G., Borggrefe T.
    Proc. Natl. Acad. Sci. U.S.A. 103:18504-18509(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH GATA1.
  6. Erratum
    Stumpf M., Waskow C., Kroetschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder R.G., Borggrefe T.
    Proc. Natl. Acad. Sci. U.S.A. 104:1442-1442(2007)

Entry informationi

Entry nameiMED14_MOUSE
AccessioniPrimary (citable) accession number: A2ABV5
Secondary accession number(s): Q3TQU3
, Q6P1H5, Q9R0T1, Q9WTN9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: February 20, 2007
Last modified: October 29, 2014
This is version 68 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3