Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A2ABV5 (MED14_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 63. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Mediator of RNA polymerase II transcription subunit 14
Alternative name(s):
Cofactor required for Sp1 transcriptional activation subunit 2
Short name=CRSP complex subunit 2
Mediator complex subunit 14
Thyroid hormone receptor-associated protein complex 170 kDa component
Short name=Trap170
Gene names
Name:Med14
Synonyms:Crsp2, Gm641, Trap170
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1459 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors By similarity.

Subunit structure

Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. Interacts with AR, ESR1, SREBF1 and STAT2 By similarity. Interacts with GATA1. Ref.5

Subcellular location

Nucleus Probable.

Sequence similarities

Belongs to the Mediator complex subunit 14 family.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A2ABV5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A2ABV5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     747-770: PSRHVYLTYENLLSEPVGGRKVVE → KIFHTVFLLMSIFLKVLVTISFFL
     771-1459: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: A2ABV5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     436-471: SIETALPALIVPILEPCGNSECLHIFVDLHSGMFQL → KHSRAGEMAQQLRVPTALPKVLSSNPINHMVAHNHL
     472-1459: Missing.
Isoform 4 (identifier: A2ABV5-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.
     435-1459: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 14591459Mediator of RNA polymerase II transcription subunit 14
PRO_0000304585

Regions

Region194 – 572379Interaction with STAT2 By similarity
Region506 – 830325Interaction with SREBF1 By similarity
Motif75 – 795LXXLL motif 1
Motif1187 – 11915LXXLL motif 2
Compositional bias31 – 5121Ala-rich
Compositional bias1008 – 1170163Pro-rich

Amino acid modifications

Modified residue6231Phosphoserine By similarity
Modified residue9921Phosphoserine By similarity
Modified residue11171Phosphoserine By similarity
Modified residue11241Phosphoserine By similarity
Modified residue11331Phosphoserine By similarity
Modified residue11411Phosphoserine By similarity
Modified residue11491Phosphoserine By similarity

Natural variations

Alternative sequence1 – 7272Missing in isoform 4.
VSP_028033
Alternative sequence435 – 14591025Missing in isoform 4.
VSP_028034
Alternative sequence436 – 47136SIETA…GMFQL → KHSRAGEMAQQLRVPTALPK VLSSNPINHMVAHNHL in isoform 3.
VSP_028035
Alternative sequence472 – 1459988Missing in isoform 3.
VSP_028036
Alternative sequence747 – 77024PSRHV…RKVVE → KIFHTVFLLMSIFLKVLVTI SFFL in isoform 2.
VSP_028037
Alternative sequence771 – 1459689Missing in isoform 2.
VSP_028038

Experimental info

Sequence conflict1581F → C in BAE37289. Ref.2
Sequence conflict346 – 3472WN → C in BAA76611. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 20, 2007. Version 1.
Checksum: FE61E45E8E99E4E9

FASTA1,459160,966
        10         20         30         40         50         60 
MAPVQLDNHQ LIPPGGGGGS SGGGGSSSGS ASAPAPPPPA AAVAAAAAAA ASPGYRLSTL 

        70         80         90        100        110        120 
IEFLLHRAYS ELMVLTDLLP RKSDVERKIE IVQFASRTRQ LFVRLLALVK WANDAGKVEK 

       130        140        150        160        170        180 
CAMISSFLDQ QAILFVDTAD RLASLARDAL VHARLPSFAI PYAIDVLTTG SYPRLPTCIR 

       190        200        210        220        230        240 
DKIIPPDPIT KIEKQATLHQ LNQILRHRLV TTDLPPQLAN LTVANGRVKF RVEGEFEATL 

       250        260        270        280        290        300 
TVMGDDPEVP WRLLKLEILV EDKETGDGRA LVHSMQIDFI HQLVQSRLFA DEKPLQDMYN 

       310        320        330        340        350        360 
CLHCFCLSLQ LEVLHSQTLM LIRERWGDLV QVERYHAGKS LSLSVWNQQV LGRKTGTASV 

       370        380        390        400        410        420 
HKVTIKIDEN DVSKPLQIFH DPPLPASDSK LVERAMKIDH LSIEKLLIDS VHARAHQRLQ 

       430        440        450        460        470        480 
ELKAILRSFN ANESSSIETA LPALIVPILE PCGNSECLHI FVDLHSGMFQ LMLYGLDPAT 

       490        500        510        520        530        540 
LEDMEKSLND DMKRIIPWIQ QLKFWLGQQR CKQSIKHLPT ITTETLQLAN YSTHPIGSLS 

       550        560        570        580        590        600 
KNKLFIKLTR LPQYYIVVEM LEVPNKPTQL SYNYYFMSVS TADREDSPVM ALLLQQFKDN 

       610        620        630        640        650        660 
IQDLMSYTKT GKQTRTGTKH KLSDDPCPID SKKAKRSGEM CAFNKVLAHF VAMCDTNMPF 

       670        680        690        700        710        720 
VGLRLELSNL EIPHQGVQVE GDGFNHAIRL LKIPPCKGIS EETQKALDRS LLDCTFRLQG 

       730        740        750        760        770        780 
RNNRTWVAEL VFANCPLNGT STREQGPSRH VYLTYENLLS EPVGGRKVVE MFLNDWSSIA 

       790        800        810        820        830        840 
RLYECVLEFA RSLPEIPAHL NIFSEVRVYN YRKLILCYGT TKGSSISIQW NSIHQKFHIA 

       850        860        870        880        890        900 
LGTVGPNSGC SNCHNTILHQ LQEMFNKTPN VVQLLQVLFD TQAPLNAINK LPTVPMLGLT 

       910        920        930        940        950        960 
QRTNTAYQCF SILPQSSTHI RLAFRNMYCI DIYCRSRGVV AIRDGAYSLF DNSKLVEGFY 

       970        980        990       1000       1010       1020 
PAPGLKTFLN MFVDSNQDAR RRSVNEDDNP PSPIGGDMMD SLISQLQPPQ QQPFPKQPGT 

      1030       1040       1050       1060       1070       1080 
SGAYPLTSPP TSYHSTVNQS PSMMHTQSPG NLHAASSPSG ALRAPSPASF VPTPPPSSHG 

      1090       1100       1110       1120       1130       1140 
ISIGPGASFA SPHGTLDPSS PYTMVSPSGR AGNWPGSPQV SGPSPATRLP GMSPANPSLH 

      1150       1160       1170       1180       1190       1200 
SPVPDVSHSP RAGTSSQTMP TNMPPPRKLP QRSWAASIPT ILTHSALNIL LLPSPTPGLV 

      1210       1220       1230       1240       1250       1260 
PGLAGSYLCS PLERFLGSVI MRRHLQRIIQ QETLQLINSN EPGVIMFKTD ALKCRVALSP 

      1270       1280       1290       1300       1310       1320 
KTNQTLQLKV TPENAGQWKP DELQVLEKFF ETRVAGPPFK ANTLIAFTKL LGAPTHILRD 

      1330       1340       1350       1360       1370       1380 
CVHIMKLELF PDQATQLKWN VQFCLTIPPS APPIAPPGTP AVVLKSKMLF FLQLTQKTSV 

      1390       1400       1410       1420       1430       1440 
PPQEPVSIIV PIIYDMASGT TQQADIPRQQ NSSVAAPMMV SNILKRFAEM NPPRQGECTI 

      1450 
FAAVRDLMAN LTLPPGGRP 

« Hide

Isoform 2 [UniParc].

Checksum: AE645E84E4B373E2
Show »

FASTA77086,050
Isoform 3 [UniParc].

Checksum: 9E560273E9D3CC85
Show »

FASTA47151,942
Isoform 4 [UniParc].

Checksum: 2F6672DA26CFE08C
Show »

FASTA36241,127

References

« Hide 'large scale' references
[1]"Detection and cloning of an X-linked locus associated with a NotI site that is not methylated on mouse inactivated X chromosome by the RLGS-M method."
Takada S., Kamiya M., Arima T., Kagebayashi H., Shibata H., Muramatsu M., Chapman V.M., Wake N., Hayashizaki Y., Takagi N.
Genomics 61:92-100(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3).
Strain: C57BL/6J.
Tissue: Kidney.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Strain: C57BL/6J.
Tissue: Egg.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6.
Tissue: Brain.
[5]"The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220."
Stumpf M., Waskow C., Kroetschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder R.G., Borggrefe T.
Proc. Natl. Acad. Sci. U.S.A. 103:18504-18509(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH GATA1.
[6]Erratum
Stumpf M., Waskow C., Kroetschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder R.G., Borggrefe T.
Proc. Natl. Acad. Sci. U.S.A. 104:1442-1442(2007)
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB019028 mRNA. Translation: BAA76610.1.
AB019029 Genomic DNA. Translation: BAA76611.1.
AK163306 mRNA. Translation: BAE37289.1.
AL662925, BX000537 Genomic DNA. Translation: CAM17981.1.
BX000537, AL662925 Genomic DNA. Translation: CAM27890.1.
BC065072 mRNA. Translation: AAH65072.1.
RefSeqNP_001041673.1. NM_001048208.1.
NP_036135.3. NM_012005.3.
UniGeneMm.17616.

3D structure databases

ProteinModelPortalA2ABV5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid205047. 4 interactions.
IntActA2ABV5. 4 interactions.

PTM databases

PhosphoSiteA2ABV5.

Proteomic databases

PaxDbA2ABV5.
PRIDEA2ABV5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000096495; ENSMUSP00000094239; ENSMUSG00000064127. [A2ABV5-1]
GeneID26896.
KEGGmmu:26896.
UCSCuc009sqz.1. mouse. [A2ABV5-1]
uc009srd.1. mouse. [A2ABV5-3]

Organism-specific databases

CTD9282.
MGIMGI:1349442. Med14.

Phylogenomic databases

eggNOGNOG281210.
GeneTreeENSGT00390000001021.
HOGENOMHOG000045361.
HOVERGENHBG104308.
InParanoidA2ABV5.
KOK15156.
OMASTHPIGN.
OrthoDBEOG7SR4KK.
PhylomeDBA2ABV5.
TreeFamTF314388.

Enzyme and pathway databases

ReactomeREACT_188576. Developmental Biology.
REACT_27166. Transcriptional Regulation of Adipocyte Differentiation in 3T3-L1 Pre-adipocytes.

Gene expression databases

ArrayExpressA2ABV5.
BgeeA2ABV5.
CleanExMM_MED14.
GenevestigatorA2ABV5.

Family and domain databases

InterProIPR013947. Mediator_Med14.
[Graphical view]
PfamPF08638. Med14. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio304735.
PROA2ABV5.
SOURCESearch...

Entry information

Entry nameMED14_MOUSE
AccessionPrimary (citable) accession number: A2ABV5
Secondary accession number(s): Q3TQU3 expand/collapse secondary AC list , Q6P1H5, Q9R0T1, Q9WTN9
Entry history
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: February 20, 2007
Last modified: April 16, 2014
This is version 63 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot