Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A2A863

- ITB4_MOUSE

UniProt

A2A863 - ITB4_MOUSE

Protein

Integrin beta-4

Gene

Itgb4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 78 (01 Oct 2014)
      Sequence version 1 (20 Feb 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility By similarity.By similarity

    GO - Molecular functioni

    1. receptor activity Source: InterPro

    GO - Biological processi

    1. cell adhesion Source: MGI
    2. cell-matrix adhesion Source: InterPro
    3. cell motility Source: UniProtKB
    4. filopodium assembly Source: MGI
    5. hemidesmosome assembly Source: InterPro
    6. integrin-mediated signaling pathway Source: UniProtKB-KW
    7. multicellular organismal development Source: InterPro
    8. response to wounding Source: UniProtKB

    Keywords - Molecular functioni

    Integrin, Receptor

    Keywords - Biological processi

    Cell adhesion

    Enzyme and pathway databases

    ReactomeiREACT_202342. Laminin interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Integrin beta-4
    Alternative name(s):
    CD_antigen: CD104
    Gene namesi
    Name:Itgb4
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:96613. Itgb4.

    Subcellular locationi

    Cell membrane By similarity; Single-pass type I membrane protein By similarity. Cell membrane By similarity; Lipid-anchor By similarity. Cell junctionhemidesmosome By similarity
    Note: Colocalizes with DST at the leading edge of migrating keratinocytes.By similarity

    GO - Cellular componenti

    1. basal plasma membrane Source: MGI
    2. basement membrane Source: MGI
    3. cell leading edge Source: UniProtKB
    4. hemidesmosome Source: MGI
    5. integrin complex Source: MGI
    6. receptor complex Source: MGI

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2828By similarityAdd
    BLAST
    Chaini29 – 18181790Integrin beta-4PRO_0000379078Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi31 ↔ 457By similarity
    Disulfide bondi39 ↔ 49By similarity
    Disulfide bondi42 ↔ 73By similarity
    Disulfide bondi52 ↔ 62By similarity
    Disulfide bondi246 ↔ 289By similarity
    Glycosylationi328 – 3281N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi425 ↔ 673By similarity
    Disulfide bondi454 ↔ 459By similarity
    Disulfide bondi470 ↔ 481By similarity
    Disulfide bondi478 ↔ 514By similarity
    Disulfide bondi483 ↔ 492By similarity
    Glycosylationi493 – 4931N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi494 ↔ 505By similarity
    Disulfide bondi520 ↔ 525By similarity
    Disulfide bondi522 ↔ 553By similarity
    Disulfide bondi527 ↔ 538By similarity
    Disulfide bondi559 ↔ 564By similarity
    Disulfide bondi566 ↔ 575By similarity
    Disulfide bondi577 ↔ 584By similarity
    Glycosylationi581 – 5811N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi598 ↔ 603By similarity
    Disulfide bondi600 ↔ 650By similarity
    Disulfide bondi605 ↔ 616By similarity
    Glycosylationi619 – 6191N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi628 ↔ 637By similarity
    Disulfide bondi634 ↔ 708By similarity
    Disulfide bondi653 ↔ 682By similarity
    Glycosylationi697 – 6971N-linked (GlcNAc...)Sequence Analysis
    Modified residuei1526 – 15261PhosphothreonineBy similarity

    Post-translational modificationi

    Palmitoylated by DHHC3 at several cysteines of the membrane-proximal region, enhancing stability and cell surface expression. Palmitoylation also promotes secundary association with tertaspanins By similarity.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    MaxQBiA2A863.
    PaxDbiA2A863.
    PRIDEiA2A863.

    PTM databases

    PhosphoSiteiA2A863.

    Expressioni

    Gene expression databases

    ArrayExpressiA2A863.
    BgeeiA2A863.
    GenevestigatoriA2A863.

    Interactioni

    Subunit structurei

    Heterodimer of an alpha and a beta subunit. Beta-4 associates with alpha-6. Interacts (via cytoplasmic region) with COL17A1 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST isoform 3 (via N-terminus). Interacts (via cytoplasmic domain) with DST (via N-terminus). Interacts with RAC1 By similarity.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliA2A863.
    SMRiA2A863. Positions 29-711, 933-1111, 1128-1340, 1515-1746.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini29 – 712684ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini734 – 18181085CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei713 – 73321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini30 – 7445PSIAdd
    BLAST
    Domaini132 – 310179VWFAAdd
    BLAST
    Repeati458 – 50447IAdd
    BLAST
    Repeati505 – 54440IIAdd
    BLAST
    Repeati545 – 58339IIIAdd
    BLAST
    Repeati584 – 62138IVAdd
    BLAST
    Domaini981 – 1086106Calx-betaAdd
    BLAST
    Domaini1131 – 122090Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1224 – 1323100Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1526 – 162196Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini1639 – 173597Fibronectin type-III 4PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni458 – 621164Cysteine-rich tandem repeatsAdd
    BLAST
    Regioni734 – 75118Palmitoylated on several cysteinesBy similarityAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi473 – 4753Cell attachment siteSequence Analysis
    Motifi1005 – 10073Cell attachment siteSequence Analysis

    Domaini

    The fibronectin type-III-like domains bind BPAG1 and plectin and probably also recruit BP230.By similarity

    Sequence similaritiesi

    Belongs to the integrin beta chain family.Curated
    Contains 1 Calx-beta domain.Curated
    Contains 4 fibronectin type-III domains.PROSITE-ProRule annotation
    Contains 1 PSI domain.Curated
    Contains 1 VWFA domain.Curated

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG303049.
    GeneTreeiENSGT00730000110513.
    HOGENOMiHOG000231105.
    InParanoidiA2A863.
    KOiK06525.
    OMAiTIIKEQA.
    OrthoDBiEOG7T7GSB.
    PhylomeDBiA2A863.
    TreeFamiTF105392.

    Family and domain databases

    Gene3Di2.60.40.10. 4 hits.
    3.40.50.410. 1 hit.
    InterProiIPR003644. Calx_beta.
    IPR013032. EGF-like_CS.
    IPR003961. Fibronectin_type3.
    IPR013783. Ig-like_fold.
    IPR015812. Integrin_bsu.
    IPR012013. Integrin_bsu-4.
    IPR002369. Integrin_bsu_N.
    IPR012896. Integrin_bsu_tail.
    IPR016201. Plexin-like_fold.
    IPR002035. VWF_A.
    [Graphical view]
    PANTHERiPTHR10082. PTHR10082. 1 hit.
    PTHR10082:SF6. PTHR10082:SF6. 1 hit.
    PfamiPF03160. Calx-beta. 1 hit.
    PF00041. fn3. 4 hits.
    PF07965. Integrin_B_tail. 1 hit.
    PF00362. Integrin_beta. 1 hit.
    [Graphical view]
    PIRSFiPIRSF002513. Integrin_B4. 1 hit.
    PRINTSiPR01186. INTEGRINB.
    SMARTiSM00237. Calx_beta. 1 hit.
    SM00060. FN3. 4 hits.
    SM00187. INB. 1 hit.
    SM00423. PSI. 1 hit.
    SM00327. VWA. 1 hit.
    [Graphical view]
    SUPFAMiSSF103575. SSF103575. 1 hit.
    SSF49265. SSF49265. 2 hits.
    SSF53300. SSF53300. 1 hit.
    SSF69687. SSF69687. 1 hit.
    PROSITEiPS00022. EGF_1. 2 hits.
    PS01186. EGF_2. 2 hits.
    PS50853. FN3. 4 hits.
    PS00243. INTEGRIN_BETA. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A2A863-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGPCCSPWV KLLLLAAMLS ASLPGDLANR CKKAQVKSCT ECIRVDKSCA     50
    YCTDELFKER RCNTQAELLA AGCRGESILV MESSLEITEN TQIDTSLHRS 100
    QVSPQGLQVR LRPGEERSFV FQVFEPLESP VDLYILMDFS NSMSDDLDNL 150
    KQMGQNLAKI LRQLTSDYTI GFGKFVDKVS VPQTDMRPEK LKEPWPNSDP 200
    PFSFKNVISL TENVEEFWNK LQGERISGNL DAPEGGFDAI LQTAVCTRDI 250
    GWRADSTHLL VFSTESAFHY EADGANVLAG IMNRNDEKCH LDASGAYTQY 300
    KTQDYPSVPT LVRLLAKHNI IPIFAVTNYS YSYYEKLHKY FPVSSLGVLQ 350
    EDSSNIVELL EEAFYRIRSN LDIRALDSPR GLRTEVTSDT LQKTETGSFH 400
    IKRGEVGTYN VHLRAVEDID GTHVCQLAKE DQGGNIHLKP SFSDGLRMDA 450
    SVICDVCPCE LQKEVRSARC HFRGDFMCGH CVCNEGWSGK TCNCSTGSLS 500
    DTQPCLREGE DKPCSGHGEC QCGRCVCYGE GRYEGHFCEY DNFQCPRTSG 550
    FLCNDRGRCS MGECVCEPGW TGRSCDCPLS NATCIDSNGG ICNGRGYCEC 600
    GRCHCNQQSL YTDTTCEINY SAIRLGLCED LRSCVQCQAW GTGEKKGRAC 650
    DDCPFKVKMV DELKKAEEVV EYCSFRDEDD DCTYSYNVEG DGSPGPNSTV 700
    LVHKKKDCPP GSFWWLIPLL IFLLLLLALL LLLCWKYCAC CKACLGLLPC 750
    CNRGHMVGFK EDHYMLRENL MASDHLDTPM LRSGNLKGRD TVRWKITNNV 800
    QRPGFATHAA STSPTELVPY GLSLRLGRLC TENLMKPGTR ECDQLRQEVE 850
    ENLNEVYRQV SGAHKLQQTK FRQQPNTGKK QDHTIVDTVL LAPRSAKQML 900
    LKLTEKQVEQ GSFHELKVAP GYYTVTAEQD ARGMVEFQEG VELVDVRVPL 950
    FIRPEDDDEK QLLVEAIDVP VGTATLGRRL VNITIIKEQA SGVVSFEQPE 1000
    YSVSRGDQVA RIPVIRHILD NGKSQVSYST QDNTAHGHRD YVPVEGELLF 1050
    HPGETWKELQ VKLLELQEVD SLLRGRQVRR FQVQLSNPKF GARLGQPSTT 1100
    TVILGEHDET DRSLINQTLS SPPPPHGDLG APQNPNAKAA GSRKIHFNWL 1150
    PPPGKPMGYR VKYWIQGDSE SEAHLLDSKV PSVELTNLYP YCDYEMKVCA 1200
    YGAQGEGPYS SLVSCRTHQE VPSEPGRLAF NVVSSTVTQL SWAEPAETNG 1250
    EITAYEVCYG LVNEDNRPIG PMKKVLVDNP KNRMLLIENL RESQPYRYTV 1300
    KARNGAGWGP EREAIINLAT QPKRPMSIPI IPDIPIVDAQ GGEDYENFLM 1350
    YSDDVLRSPA SSQRPSVSDD TGCGWKFEPL LGEELDLRRV TWRLPPELIP 1400
    RLSASSGRSD EDGSVAGGVE GEGSGWIRGA TPRPPGEHLV NGRMDFAYPG 1450
    SANSLHRMTA ANVAYGTHLS PHLSHRVLST SSTLTRDYHS LTRTEHSHSG 1500
    TLPRDYSTLT SLSSQDSRGA VGVPDTPTRL VFSALGPTSL KVSWQEPQCD 1550
    RMLLGYSVEY QLLNGGEMHR LNIPNPGQTS VVVEDLLPNH SYVFRVRAQS 1600
    QEGWGREREG VITIESQVHP QSPLCPLPGS AFTLSTPSAP GPLVFTALSP 1650
    DSLQLSWERP RRPNGDILGY LVTCEMAQGG APARTFRVDG DNPESRLTVP 1700
    GLSENVPYKF KVQARTTEGF GPEREGIITI ESQVGGPFPQ LGSHSGLFQN 1750
    PVQSEFSSVT STHSTTTEPF LMDGLTLGTQ RLEAGGSLTR HVTQEFVTRT 1800
    LTASGSLSTH MDQQFFQT 1818
    Length:1,818
    Mass (Da):201,650
    Last modified:February 20, 2007 - v1
    Checksum:iCA41A7E6B4E20B59
    GO
    Isoform 2 (identifier: A2A863-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1372-1436: Missing.

    Show »
    Length:1,753
    Mass (Da):194,753
    Checksum:i1417FAE0584640A5
    GO
    Isoform 3 (identifier: A2A863-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1372-1436: Missing.
         1515-1515: Q → QGLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRGSPDSIILAGQSAAPSWGT

    Show »
    Length:1,806
    Mass (Da):200,261
    Checksum:i89554C47CE0DC661
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti17 – 171A → R(PubMed:8359687)Curated
    Sequence conflicti67 – 682EL → DV(PubMed:8359687)Curated
    Sequence conflicti94 – 941D → V(PubMed:8359687)Curated
    Sequence conflicti113 – 1131P → R(PubMed:8359687)Curated
    Sequence conflicti118 – 1181S → T(PubMed:8359687)Curated
    Sequence conflicti624 – 6241Missing(PubMed:8359687)Curated
    Sequence conflicti666 – 6661Missing(PubMed:8359687)Curated
    Sequence conflicti709 – 7135PPGSF → LPAPS(PubMed:8359687)Curated
    Sequence conflicti851 – 8511E → K in AAH59192. (PubMed:15489334)Curated
    Sequence conflicti877 – 8771T → A(PubMed:8359687)Curated
    Sequence conflicti877 – 8771T → A in AAH06632. (PubMed:15489334)Curated
    Sequence conflicti877 – 8771T → A in AAH59192. (PubMed:15489334)Curated
    Sequence conflicti972 – 9721G → S(PubMed:8359687)Curated
    Sequence conflicti1105 – 11073Missing(PubMed:8359687)Curated
    Sequence conflicti1204 – 12041Q → K(PubMed:8359687)Curated
    Sequence conflicti1292 – 12921E → D(PubMed:8359687)Curated
    Sequence conflicti1537 – 15371P → R(PubMed:8359687)Curated
    Sequence conflicti1552 – 15521M → T(PubMed:8359687)Curated
    Sequence conflicti1552 – 15521M → T in AAH06632. (PubMed:15489334)Curated
    Sequence conflicti1552 – 15521M → T in AAH25194. (PubMed:15489334)Curated
    Sequence conflicti1552 – 15521M → T in AAH59192. (PubMed:15489334)Curated
    Sequence conflicti1564 – 15663NGG → TCV(PubMed:8359687)Curated
    Sequence conflicti1590 – 15923HSY → YSH(PubMed:8359687)Curated
    Sequence conflicti1653 – 16531L → P(PubMed:8359687)Curated
    Sequence conflicti1662 – 16632RP → SR(PubMed:8359687)Curated
    Sequence conflicti1744 – 17441H → N(PubMed:8359687)Curated
    Sequence conflicti1759 – 17591V → M in AAH25194. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1372 – 143665Missing in isoform 2 and isoform 3. 2 PublicationsVSP_037636Add
    BLAST
    Alternative sequencei1515 – 15151Q → QGLPPIWEDGRSRLPLSWTL GSLSRAHMKGVPASRGSPDS IILAGQSAAPSWGT in isoform 3. CuratedVSP_037637

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL607108, AL645647 Genomic DNA. Translation: CAM24050.1.
    AL607108, AL645647 Genomic DNA. Translation: CAM24052.1.
    AL607108, AL645647 Genomic DNA. Translation: CAM24053.1.
    BC006632 mRNA. Translation: AAH06632.1.
    BC025194 mRNA. Translation: AAH25194.1.
    BC059192 mRNA. Translation: AAH59192.1.
    PIRiJN0786.
    RefSeqiXP_006532635.1. XM_006532572.1. [A2A863-1]
    XP_006532636.1. XM_006532573.1. [A2A863-3]
    XP_006532637.1. XM_006532574.1. [A2A863-2]
    UniGeneiMm.213873.

    Genome annotation databases

    EnsembliENSMUST00000068981; ENSMUSP00000070811; ENSMUSG00000020758. [A2A863-2]
    ENSMUST00000106458; ENSMUSP00000102066; ENSMUSG00000020758. [A2A863-1]
    ENSMUST00000106460; ENSMUSP00000102068; ENSMUSG00000020758. [A2A863-3]
    ENSMUST00000106461; ENSMUSP00000102069; ENSMUSG00000020758. [A2A863-1]
    GeneIDi192897.
    KEGGimmu:192897.
    UCSCiuc007mji.1. mouse. [A2A863-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL607108 , AL645647 Genomic DNA. Translation: CAM24050.1 .
    AL607108 , AL645647 Genomic DNA. Translation: CAM24052.1 .
    AL607108 , AL645647 Genomic DNA. Translation: CAM24053.1 .
    BC006632 mRNA. Translation: AAH06632.1 .
    BC025194 mRNA. Translation: AAH25194.1 .
    BC059192 mRNA. Translation: AAH59192.1 .
    PIRi JN0786.
    RefSeqi XP_006532635.1. XM_006532572.1. [A2A863-1 ]
    XP_006532636.1. XM_006532573.1. [A2A863-3 ]
    XP_006532637.1. XM_006532574.1. [A2A863-2 ]
    UniGenei Mm.213873.

    3D structure databases

    ProteinModelPortali A2A863.
    SMRi A2A863. Positions 29-711, 933-1111, 1128-1340, 1515-1746.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei A2A863.

    Proteomic databases

    MaxQBi A2A863.
    PaxDbi A2A863.
    PRIDEi A2A863.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000068981 ; ENSMUSP00000070811 ; ENSMUSG00000020758 . [A2A863-2 ]
    ENSMUST00000106458 ; ENSMUSP00000102066 ; ENSMUSG00000020758 . [A2A863-1 ]
    ENSMUST00000106460 ; ENSMUSP00000102068 ; ENSMUSG00000020758 . [A2A863-3 ]
    ENSMUST00000106461 ; ENSMUSP00000102069 ; ENSMUSG00000020758 . [A2A863-1 ]
    GeneIDi 192897.
    KEGGi mmu:192897.
    UCSCi uc007mji.1. mouse. [A2A863-2 ]

    Organism-specific databases

    CTDi 3691.
    MGIi MGI:96613. Itgb4.

    Phylogenomic databases

    eggNOGi NOG303049.
    GeneTreei ENSGT00730000110513.
    HOGENOMi HOG000231105.
    InParanoidi A2A863.
    KOi K06525.
    OMAi TIIKEQA.
    OrthoDBi EOG7T7GSB.
    PhylomeDBi A2A863.
    TreeFami TF105392.

    Enzyme and pathway databases

    Reactomei REACT_202342. Laminin interactions.

    Miscellaneous databases

    ChiTaRSi ITGB4. mouse.
    PROi A2A863.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi A2A863.
    Bgeei A2A863.
    Genevestigatori A2A863.

    Family and domain databases

    Gene3Di 2.60.40.10. 4 hits.
    3.40.50.410. 1 hit.
    InterProi IPR003644. Calx_beta.
    IPR013032. EGF-like_CS.
    IPR003961. Fibronectin_type3.
    IPR013783. Ig-like_fold.
    IPR015812. Integrin_bsu.
    IPR012013. Integrin_bsu-4.
    IPR002369. Integrin_bsu_N.
    IPR012896. Integrin_bsu_tail.
    IPR016201. Plexin-like_fold.
    IPR002035. VWF_A.
    [Graphical view ]
    PANTHERi PTHR10082. PTHR10082. 1 hit.
    PTHR10082:SF6. PTHR10082:SF6. 1 hit.
    Pfami PF03160. Calx-beta. 1 hit.
    PF00041. fn3. 4 hits.
    PF07965. Integrin_B_tail. 1 hit.
    PF00362. Integrin_beta. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF002513. Integrin_B4. 1 hit.
    PRINTSi PR01186. INTEGRINB.
    SMARTi SM00237. Calx_beta. 1 hit.
    SM00060. FN3. 4 hits.
    SM00187. INB. 1 hit.
    SM00423. PSI. 1 hit.
    SM00327. VWA. 1 hit.
    [Graphical view ]
    SUPFAMi SSF103575. SSF103575. 1 hit.
    SSF49265. SSF49265. 2 hits.
    SSF53300. SSF53300. 1 hit.
    SSF69687. SSF69687. 1 hit.
    PROSITEi PS00022. EGF_1. 2 hits.
    PS01186. EGF_2. 2 hits.
    PS50853. FN3. 4 hits.
    PS00243. INTEGRIN_BETA. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Sequence of a cDNA encoding the beta 4 subunit of murine integrin."
      Kennel S.J., Foote L.J., Cimino L., Rizzo M.G., Chang L.Y., Sacchi A.
      Gene 130:209-216(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 124-1818 (ISOFORM 2).
      Strain: Czech II and FVB/N.
      Tissue: Mammary tumor.

    Entry informationi

    Entry nameiITB4_MOUSE
    AccessioniPrimary (citable) accession number: A2A863
    Secondary accession number(s): A2A865
    , A2A866, Q6PCS0, Q8R3J1, Q91W15
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 7, 2009
    Last sequence update: February 20, 2007
    Last modified: October 1, 2014
    This is version 78 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3