Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A2A863 (ITB4_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 74. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Integrin beta-4
Alternative name(s):
CD_antigen=CD104
Gene names
Name:Itgb4
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1818 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility By similarity.

Subunit structure

Heterodimer of an alpha and a beta subunit. Beta-4 associates with alpha-6. Interacts (via cytoplasmic region) with COL17A1 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST isoform 3 (via N-terminus). Interacts (via cytoplasmic domain) with DST (via N-terminus). Interacts with RAC1 By similarity.

Subcellular location

Membrane; Single-pass type I membrane protein By similarity. Cell junctionhemidesmosome By similarity. Note: Colocalizes with DST at the leading edge of migrating keratinocytes By similarity.

Domain

The fibronectin type-III-like domains bind BPAG1 and plectin and probably also recruit BP230 By similarity.

Sequence similarities

Belongs to the integrin beta chain family.

Contains 1 Calx-beta domain.

Contains 4 fibronectin type-III domains.

Contains 1 PSI domain.

Contains 1 VWFA domain.

Ontologies

Keywords
   Biological processCell adhesion
   Cellular componentCell junction
Membrane
   Coding sequence diversityAlternative splicing
   DomainRepeat
Signal
Transmembrane
Transmembrane helix
   Molecular functionIntegrin
Receptor
   PTMDisulfide bond
Glycoprotein
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell adhesion

Inferred from mutant phenotype PubMed 8707838. Source: MGI

cell motility

Inferred from sequence or structural similarity. Source: UniProtKB

cell-matrix adhesion

Inferred from electronic annotation. Source: InterPro

filopodium assembly

Inferred from mutant phenotype PubMed 16365040. Source: MGI

hemidesmosome assembly

Inferred from electronic annotation. Source: InterPro

integrin-mediated signaling pathway

Inferred from electronic annotation. Source: UniProtKB-KW

multicellular organismal development

Inferred from electronic annotation. Source: InterPro

response to wounding

Inferred from sequence or structural similarity. Source: UniProtKB

   Cellular_componentbasal plasma membrane

Inferred from direct assay PubMed 11891657PubMed 21464233. Source: MGI

basement membrane

Inferred from direct assay PubMed 17011173. Source: MGI

cell leading edge

Inferred from sequence or structural similarity. Source: UniProtKB

hemidesmosome

Inferred from direct assay PubMed 22274697. Source: MGI

integrin complex

Inferred from direct assay PubMed 8707838. Source: MGI

receptor complex

Inferred from sequence orthology PubMed 23382219. Source: MGI

   Molecular_functionreceptor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A2A863-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A2A863-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1372-1436: Missing.
Isoform 3 (identifier: A2A863-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1372-1436: Missing.
     1515-1515: Q → QGLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRGSPDSIILAGQSAAPSWGT

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2828 By similarity
Chain29 – 18181790Integrin beta-4
PRO_0000379078

Regions

Topological domain29 – 712684Extracellular Potential
Transmembrane713 – 73321Helical; Potential
Topological domain734 – 18181085Cytoplasmic Potential
Domain30 – 7445PSI
Domain132 – 310179VWFA
Repeat458 – 50447I
Repeat505 – 54440II
Repeat545 – 58339III
Repeat584 – 62138IV
Domain981 – 1086106Calx-beta
Domain1131 – 122090Fibronectin type-III 1
Domain1224 – 1323100Fibronectin type-III 2
Domain1526 – 162196Fibronectin type-III 3
Domain1639 – 173597Fibronectin type-III 4
Region458 – 621164Cysteine-rich tandem repeats
Motif473 – 4753Cell attachment site Potential
Motif1005 – 10073Cell attachment site Potential

Amino acid modifications

Modified residue15261Phosphothreonine By similarity
Glycosylation3281N-linked (GlcNAc...) Potential
Glycosylation4931N-linked (GlcNAc...) Potential
Glycosylation5811N-linked (GlcNAc...) Potential
Glycosylation6191N-linked (GlcNAc...) Potential
Glycosylation6971N-linked (GlcNAc...) Potential
Disulfide bond31 ↔ 457 By similarity
Disulfide bond39 ↔ 49 By similarity
Disulfide bond42 ↔ 73 By similarity
Disulfide bond52 ↔ 62 By similarity
Disulfide bond246 ↔ 289 By similarity
Disulfide bond425 ↔ 673 By similarity
Disulfide bond454 ↔ 459 By similarity
Disulfide bond470 ↔ 481 By similarity
Disulfide bond478 ↔ 514 By similarity
Disulfide bond483 ↔ 492 By similarity
Disulfide bond494 ↔ 505 By similarity
Disulfide bond520 ↔ 525 By similarity
Disulfide bond522 ↔ 553 By similarity
Disulfide bond527 ↔ 538 By similarity
Disulfide bond559 ↔ 564 By similarity
Disulfide bond566 ↔ 575 By similarity
Disulfide bond577 ↔ 584 By similarity
Disulfide bond598 ↔ 603 By similarity
Disulfide bond600 ↔ 650 By similarity
Disulfide bond605 ↔ 616 By similarity
Disulfide bond628 ↔ 637 By similarity
Disulfide bond634 ↔ 708 By similarity
Disulfide bond653 ↔ 682 By similarity

Natural variations

Alternative sequence1372 – 143665Missing in isoform 2 and isoform 3.
VSP_037636
Alternative sequence15151Q → QGLPPIWEDGRSRLPLSWTL GSLSRAHMKGVPASRGSPDS IILAGQSAAPSWGT in isoform 3.
VSP_037637

Experimental info

Sequence conflict171A → R Ref.1
Sequence conflict67 – 682EL → DV Ref.1
Sequence conflict941D → V Ref.1
Sequence conflict1131P → R Ref.1
Sequence conflict1181S → T Ref.1
Sequence conflict6241Missing Ref.1
Sequence conflict6661Missing Ref.1
Sequence conflict709 – 7135PPGSF → LPAPS Ref.1
Sequence conflict8511E → K in AAH59192. Ref.3
Sequence conflict8771T → A Ref.1
Sequence conflict8771T → A in AAH06632. Ref.3
Sequence conflict8771T → A in AAH59192. Ref.3
Sequence conflict9721G → S Ref.1
Sequence conflict1105 – 11073Missing Ref.1
Sequence conflict12041Q → K Ref.1
Sequence conflict12921E → D Ref.1
Sequence conflict15371P → R Ref.1
Sequence conflict15521M → T Ref.1
Sequence conflict15521M → T in AAH06632. Ref.3
Sequence conflict15521M → T in AAH25194. Ref.3
Sequence conflict15521M → T in AAH59192. Ref.3
Sequence conflict1564 – 15663NGG → TCV Ref.1
Sequence conflict1590 – 15923HSY → YSH Ref.1
Sequence conflict16531L → P Ref.1
Sequence conflict1662 – 16632RP → SR Ref.1
Sequence conflict17441H → N Ref.1
Sequence conflict17591V → M in AAH25194. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 20, 2007. Version 1.
Checksum: CA41A7E6B4E20B59

FASTA1,818201,650
        10         20         30         40         50         60 
MAGPCCSPWV KLLLLAAMLS ASLPGDLANR CKKAQVKSCT ECIRVDKSCA YCTDELFKER 

        70         80         90        100        110        120 
RCNTQAELLA AGCRGESILV MESSLEITEN TQIDTSLHRS QVSPQGLQVR LRPGEERSFV 

       130        140        150        160        170        180 
FQVFEPLESP VDLYILMDFS NSMSDDLDNL KQMGQNLAKI LRQLTSDYTI GFGKFVDKVS 

       190        200        210        220        230        240 
VPQTDMRPEK LKEPWPNSDP PFSFKNVISL TENVEEFWNK LQGERISGNL DAPEGGFDAI 

       250        260        270        280        290        300 
LQTAVCTRDI GWRADSTHLL VFSTESAFHY EADGANVLAG IMNRNDEKCH LDASGAYTQY 

       310        320        330        340        350        360 
KTQDYPSVPT LVRLLAKHNI IPIFAVTNYS YSYYEKLHKY FPVSSLGVLQ EDSSNIVELL 

       370        380        390        400        410        420 
EEAFYRIRSN LDIRALDSPR GLRTEVTSDT LQKTETGSFH IKRGEVGTYN VHLRAVEDID 

       430        440        450        460        470        480 
GTHVCQLAKE DQGGNIHLKP SFSDGLRMDA SVICDVCPCE LQKEVRSARC HFRGDFMCGH 

       490        500        510        520        530        540 
CVCNEGWSGK TCNCSTGSLS DTQPCLREGE DKPCSGHGEC QCGRCVCYGE GRYEGHFCEY 

       550        560        570        580        590        600 
DNFQCPRTSG FLCNDRGRCS MGECVCEPGW TGRSCDCPLS NATCIDSNGG ICNGRGYCEC 

       610        620        630        640        650        660 
GRCHCNQQSL YTDTTCEINY SAIRLGLCED LRSCVQCQAW GTGEKKGRAC DDCPFKVKMV 

       670        680        690        700        710        720 
DELKKAEEVV EYCSFRDEDD DCTYSYNVEG DGSPGPNSTV LVHKKKDCPP GSFWWLIPLL 

       730        740        750        760        770        780 
IFLLLLLALL LLLCWKYCAC CKACLGLLPC CNRGHMVGFK EDHYMLRENL MASDHLDTPM 

       790        800        810        820        830        840 
LRSGNLKGRD TVRWKITNNV QRPGFATHAA STSPTELVPY GLSLRLGRLC TENLMKPGTR 

       850        860        870        880        890        900 
ECDQLRQEVE ENLNEVYRQV SGAHKLQQTK FRQQPNTGKK QDHTIVDTVL LAPRSAKQML 

       910        920        930        940        950        960 
LKLTEKQVEQ GSFHELKVAP GYYTVTAEQD ARGMVEFQEG VELVDVRVPL FIRPEDDDEK 

       970        980        990       1000       1010       1020 
QLLVEAIDVP VGTATLGRRL VNITIIKEQA SGVVSFEQPE YSVSRGDQVA RIPVIRHILD 

      1030       1040       1050       1060       1070       1080 
NGKSQVSYST QDNTAHGHRD YVPVEGELLF HPGETWKELQ VKLLELQEVD SLLRGRQVRR 

      1090       1100       1110       1120       1130       1140 
FQVQLSNPKF GARLGQPSTT TVILGEHDET DRSLINQTLS SPPPPHGDLG APQNPNAKAA 

      1150       1160       1170       1180       1190       1200 
GSRKIHFNWL PPPGKPMGYR VKYWIQGDSE SEAHLLDSKV PSVELTNLYP YCDYEMKVCA 

      1210       1220       1230       1240       1250       1260 
YGAQGEGPYS SLVSCRTHQE VPSEPGRLAF NVVSSTVTQL SWAEPAETNG EITAYEVCYG 

      1270       1280       1290       1300       1310       1320 
LVNEDNRPIG PMKKVLVDNP KNRMLLIENL RESQPYRYTV KARNGAGWGP EREAIINLAT 

      1330       1340       1350       1360       1370       1380 
QPKRPMSIPI IPDIPIVDAQ GGEDYENFLM YSDDVLRSPA SSQRPSVSDD TGCGWKFEPL 

      1390       1400       1410       1420       1430       1440 
LGEELDLRRV TWRLPPELIP RLSASSGRSD EDGSVAGGVE GEGSGWIRGA TPRPPGEHLV 

      1450       1460       1470       1480       1490       1500 
NGRMDFAYPG SANSLHRMTA ANVAYGTHLS PHLSHRVLST SSTLTRDYHS LTRTEHSHSG 

      1510       1520       1530       1540       1550       1560 
TLPRDYSTLT SLSSQDSRGA VGVPDTPTRL VFSALGPTSL KVSWQEPQCD RMLLGYSVEY 

      1570       1580       1590       1600       1610       1620 
QLLNGGEMHR LNIPNPGQTS VVVEDLLPNH SYVFRVRAQS QEGWGREREG VITIESQVHP 

      1630       1640       1650       1660       1670       1680 
QSPLCPLPGS AFTLSTPSAP GPLVFTALSP DSLQLSWERP RRPNGDILGY LVTCEMAQGG 

      1690       1700       1710       1720       1730       1740 
APARTFRVDG DNPESRLTVP GLSENVPYKF KVQARTTEGF GPEREGIITI ESQVGGPFPQ 

      1750       1760       1770       1780       1790       1800 
LGSHSGLFQN PVQSEFSSVT STHSTTTEPF LMDGLTLGTQ RLEAGGSLTR HVTQEFVTRT 

      1810 
LTASGSLSTH MDQQFFQT 

« Hide

Isoform 2 [UniParc].

Checksum: 1417FAE0584640A5
Show »

FASTA1,753194,753
Isoform 3 [UniParc].

Checksum: 89554C47CE0DC661
Show »

FASTA1,806200,261

References

« Hide 'large scale' references
[1]"Sequence of a cDNA encoding the beta 4 subunit of murine integrin."
Kennel S.J., Foote L.J., Cimino L., Rizzo M.G., Chang L.Y., Sacchi A.
Gene 130:209-216(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 124-1818 (ISOFORM 2).
Strain: Czech II and FVB/N.
Tissue: Mammary tumor.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AL607108, AL645647 Genomic DNA. Translation: CAM24050.1.
AL607108, AL645647 Genomic DNA. Translation: CAM24052.1.
AL607108, AL645647 Genomic DNA. Translation: CAM24053.1.
BC006632 mRNA. Translation: AAH06632.1.
BC025194 mRNA. Translation: AAH25194.1.
BC059192 mRNA. Translation: AAH59192.1.
PIRJN0786.
RefSeqXP_006532635.1. XM_006532572.1.
XP_006532636.1. XM_006532573.1.
XP_006532637.1. XM_006532574.1.
UniGeneMm.213873.

3D structure databases

ProteinModelPortalA2A863.
SMRA2A863. Positions 29-711, 933-1111, 1128-1340, 1515-1737.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteA2A863.

Proteomic databases

PaxDbA2A863.
PRIDEA2A863.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000068981; ENSMUSP00000070811; ENSMUSG00000020758. [A2A863-2]
ENSMUST00000106458; ENSMUSP00000102066; ENSMUSG00000020758. [A2A863-1]
ENSMUST00000106460; ENSMUSP00000102068; ENSMUSG00000020758. [A2A863-3]
ENSMUST00000106461; ENSMUSP00000102069; ENSMUSG00000020758. [A2A863-1]
GeneID192897.
UCSCuc007mji.1. mouse. [A2A863-2]

Organism-specific databases

MGIMGI:96613. Itgb4.

Phylogenomic databases

eggNOGNOG303049.
GeneTreeENSGT00730000110513.
HOGENOMHOG000231105.
InParanoidA2A863.
OMATIIKEQA.
OrthoDBEOG7T7GSB.
PhylomeDBA2A863.
TreeFamTF105392.

Gene expression databases

ArrayExpressA2A863.
BgeeA2A863.
GenevestigatorA2A863.

Family and domain databases

Gene3D2.60.40.10. 4 hits.
3.40.50.410. 1 hit.
InterProIPR003644. Calx_beta.
IPR013032. EGF-like_CS.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR015812. Integrin_bsu.
IPR012013. Integrin_bsu-4.
IPR002369. Integrin_bsu_N.
IPR012896. Integrin_bsu_tail.
IPR016201. Plexin-like_fold.
IPR002035. VWF_A.
[Graphical view]
PANTHERPTHR10082. PTHR10082. 1 hit.
PTHR10082:SF6. PTHR10082:SF6. 1 hit.
PfamPF03160. Calx-beta. 1 hit.
PF00041. fn3. 4 hits.
PF07965. Integrin_B_tail. 1 hit.
PF00362. Integrin_beta. 1 hit.
[Graphical view]
PIRSFPIRSF002513. Integrin_B4. 1 hit.
PRINTSPR01186. INTEGRINB.
SMARTSM00237. Calx_beta. 1 hit.
SM00060. FN3. 4 hits.
SM00187. INB. 1 hit.
SM00423. PSI. 1 hit.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMSSF103575. SSF103575. 1 hit.
SSF49265. SSF49265. 2 hits.
SSF53300. SSF53300. 1 hit.
SSF69687. SSF69687. 1 hit.
PROSITEPS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50853. FN3. 4 hits.
PS00243. INTEGRIN_BETA. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSITGB4. mouse.
PROA2A863.
SOURCESearch...

Entry information

Entry nameITB4_MOUSE
AccessionPrimary (citable) accession number: A2A863
Secondary accession number(s): A2A865 expand/collapse secondary AC list , A2A866, Q6PCS0, Q8R3J1, Q91W15
Entry history
Integrated into UniProtKB/Swiss-Prot: July 7, 2009
Last sequence update: February 20, 2007
Last modified: April 16, 2014
This is version 74 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot