SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A2A863

- ITB4_MOUSE

UniProt

A2A863 - ITB4_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Integrin beta-4
Gene
Itgb4
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility By similarity.

GO - Molecular functioni

  1. receptor activity Source: InterPro

GO - Biological processi

  1. cell adhesion Source: MGI
  2. cell motility Source: UniProtKB
  3. cell-matrix adhesion Source: InterPro
  4. filopodium assembly Source: MGI
  5. hemidesmosome assembly Source: InterPro
  6. integrin-mediated signaling pathway Source: UniProtKB-KW
  7. multicellular organismal development Source: InterPro
  8. response to wounding Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Integrin, Receptor

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiREACT_202342. Laminin interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin beta-4
Alternative name(s):
CD_antigen: CD104
Gene namesi
Name:Itgb4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:96613. Itgb4.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein By similarity. Cell membrane; Lipid-anchor By similarity. Cell junctionhemidesmosome By similarity
Note: Colocalizes with DST at the leading edge of migrating keratinocytes By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini29 – 712684Extracellular Reviewed prediction
Add
BLAST
Transmembranei713 – 73321Helical; Reviewed prediction
Add
BLAST
Topological domaini734 – 18181085Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. basal plasma membrane Source: MGI
  2. basement membrane Source: MGI
  3. cell leading edge Source: UniProtKB
  4. hemidesmosome Source: MGI
  5. integrin complex Source: MGI
  6. receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2828 By similarity
Add
BLAST
Chaini29 – 18181790Integrin beta-4
PRO_0000379078Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi31 ↔ 457 By similarity
Disulfide bondi39 ↔ 49 By similarity
Disulfide bondi42 ↔ 73 By similarity
Disulfide bondi52 ↔ 62 By similarity
Disulfide bondi246 ↔ 289 By similarity
Glycosylationi328 – 3281N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi425 ↔ 673 By similarity
Disulfide bondi454 ↔ 459 By similarity
Disulfide bondi470 ↔ 481 By similarity
Disulfide bondi478 ↔ 514 By similarity
Disulfide bondi483 ↔ 492 By similarity
Glycosylationi493 – 4931N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi494 ↔ 505 By similarity
Disulfide bondi520 ↔ 525 By similarity
Disulfide bondi522 ↔ 553 By similarity
Disulfide bondi527 ↔ 538 By similarity
Disulfide bondi559 ↔ 564 By similarity
Disulfide bondi566 ↔ 575 By similarity
Disulfide bondi577 ↔ 584 By similarity
Glycosylationi581 – 5811N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi598 ↔ 603 By similarity
Disulfide bondi600 ↔ 650 By similarity
Disulfide bondi605 ↔ 616 By similarity
Glycosylationi619 – 6191N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi628 ↔ 637 By similarity
Disulfide bondi634 ↔ 708 By similarity
Disulfide bondi653 ↔ 682 By similarity
Glycosylationi697 – 6971N-linked (GlcNAc...) Reviewed prediction
Modified residuei1526 – 15261Phosphothreonine By similarity

Post-translational modificationi

Palmitoylated by DHHC3 at several cysteines of the membrane-proximal region, enhancing stability and cell surface expression. Palmitoylation also promotes secundary association with tertaspanins By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiA2A863.
PaxDbiA2A863.
PRIDEiA2A863.

PTM databases

PhosphoSiteiA2A863.

Expressioni

Gene expression databases

ArrayExpressiA2A863.
BgeeiA2A863.
GenevestigatoriA2A863.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. Beta-4 associates with alpha-6. Interacts (via cytoplasmic region) with COL17A1 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST isoform 3 (via N-terminus). Interacts (via cytoplasmic domain) with DST (via N-terminus). Interacts with RAC1 By similarity.

Structurei

3D structure databases

ProteinModelPortaliA2A863.
SMRiA2A863. Positions 29-711, 933-1111, 1128-1340, 1515-1746.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini30 – 7445PSI
Add
BLAST
Domaini132 – 310179VWFA
Add
BLAST
Repeati458 – 50447I
Add
BLAST
Repeati505 – 54440II
Add
BLAST
Repeati545 – 58339III
Add
BLAST
Repeati584 – 62138IV
Add
BLAST
Domaini981 – 1086106Calx-beta
Add
BLAST
Domaini1131 – 122090Fibronectin type-III 1
Add
BLAST
Domaini1224 – 1323100Fibronectin type-III 2
Add
BLAST
Domaini1526 – 162196Fibronectin type-III 3
Add
BLAST
Domaini1639 – 173597Fibronectin type-III 4
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni458 – 621164Cysteine-rich tandem repeats
Add
BLAST
Regioni734 – 75118Palmitoylated on several cysteines By similarity
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi473 – 4753Cell attachment site Reviewed prediction
Motifi1005 – 10073Cell attachment site Reviewed prediction

Domaini

The fibronectin type-III-like domains bind BPAG1 and plectin and probably also recruit BP230 By similarity.

Sequence similaritiesi

Contains 1 Calx-beta domain.
Contains 1 PSI domain.
Contains 1 VWFA domain.

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG303049.
GeneTreeiENSGT00730000110513.
HOGENOMiHOG000231105.
InParanoidiA2A863.
KOiK06525.
OMAiTIIKEQA.
OrthoDBiEOG7T7GSB.
PhylomeDBiA2A863.
TreeFamiTF105392.

Family and domain databases

Gene3Di2.60.40.10. 4 hits.
3.40.50.410. 1 hit.
InterProiIPR003644. Calx_beta.
IPR013032. EGF-like_CS.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR015812. Integrin_bsu.
IPR012013. Integrin_bsu-4.
IPR002369. Integrin_bsu_N.
IPR012896. Integrin_bsu_tail.
IPR016201. Plexin-like_fold.
IPR002035. VWF_A.
[Graphical view]
PANTHERiPTHR10082. PTHR10082. 1 hit.
PTHR10082:SF6. PTHR10082:SF6. 1 hit.
PfamiPF03160. Calx-beta. 1 hit.
PF00041. fn3. 4 hits.
PF07965. Integrin_B_tail. 1 hit.
PF00362. Integrin_beta. 1 hit.
[Graphical view]
PIRSFiPIRSF002513. Integrin_B4. 1 hit.
PRINTSiPR01186. INTEGRINB.
SMARTiSM00237. Calx_beta. 1 hit.
SM00060. FN3. 4 hits.
SM00187. INB. 1 hit.
SM00423. PSI. 1 hit.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMiSSF103575. SSF103575. 1 hit.
SSF49265. SSF49265. 2 hits.
SSF53300. SSF53300. 1 hit.
SSF69687. SSF69687. 1 hit.
PROSITEiPS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50853. FN3. 4 hits.
PS00243. INTEGRIN_BETA. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A2A863-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAGPCCSPWV KLLLLAAMLS ASLPGDLANR CKKAQVKSCT ECIRVDKSCA     50
YCTDELFKER RCNTQAELLA AGCRGESILV MESSLEITEN TQIDTSLHRS 100
QVSPQGLQVR LRPGEERSFV FQVFEPLESP VDLYILMDFS NSMSDDLDNL 150
KQMGQNLAKI LRQLTSDYTI GFGKFVDKVS VPQTDMRPEK LKEPWPNSDP 200
PFSFKNVISL TENVEEFWNK LQGERISGNL DAPEGGFDAI LQTAVCTRDI 250
GWRADSTHLL VFSTESAFHY EADGANVLAG IMNRNDEKCH LDASGAYTQY 300
KTQDYPSVPT LVRLLAKHNI IPIFAVTNYS YSYYEKLHKY FPVSSLGVLQ 350
EDSSNIVELL EEAFYRIRSN LDIRALDSPR GLRTEVTSDT LQKTETGSFH 400
IKRGEVGTYN VHLRAVEDID GTHVCQLAKE DQGGNIHLKP SFSDGLRMDA 450
SVICDVCPCE LQKEVRSARC HFRGDFMCGH CVCNEGWSGK TCNCSTGSLS 500
DTQPCLREGE DKPCSGHGEC QCGRCVCYGE GRYEGHFCEY DNFQCPRTSG 550
FLCNDRGRCS MGECVCEPGW TGRSCDCPLS NATCIDSNGG ICNGRGYCEC 600
GRCHCNQQSL YTDTTCEINY SAIRLGLCED LRSCVQCQAW GTGEKKGRAC 650
DDCPFKVKMV DELKKAEEVV EYCSFRDEDD DCTYSYNVEG DGSPGPNSTV 700
LVHKKKDCPP GSFWWLIPLL IFLLLLLALL LLLCWKYCAC CKACLGLLPC 750
CNRGHMVGFK EDHYMLRENL MASDHLDTPM LRSGNLKGRD TVRWKITNNV 800
QRPGFATHAA STSPTELVPY GLSLRLGRLC TENLMKPGTR ECDQLRQEVE 850
ENLNEVYRQV SGAHKLQQTK FRQQPNTGKK QDHTIVDTVL LAPRSAKQML 900
LKLTEKQVEQ GSFHELKVAP GYYTVTAEQD ARGMVEFQEG VELVDVRVPL 950
FIRPEDDDEK QLLVEAIDVP VGTATLGRRL VNITIIKEQA SGVVSFEQPE 1000
YSVSRGDQVA RIPVIRHILD NGKSQVSYST QDNTAHGHRD YVPVEGELLF 1050
HPGETWKELQ VKLLELQEVD SLLRGRQVRR FQVQLSNPKF GARLGQPSTT 1100
TVILGEHDET DRSLINQTLS SPPPPHGDLG APQNPNAKAA GSRKIHFNWL 1150
PPPGKPMGYR VKYWIQGDSE SEAHLLDSKV PSVELTNLYP YCDYEMKVCA 1200
YGAQGEGPYS SLVSCRTHQE VPSEPGRLAF NVVSSTVTQL SWAEPAETNG 1250
EITAYEVCYG LVNEDNRPIG PMKKVLVDNP KNRMLLIENL RESQPYRYTV 1300
KARNGAGWGP EREAIINLAT QPKRPMSIPI IPDIPIVDAQ GGEDYENFLM 1350
YSDDVLRSPA SSQRPSVSDD TGCGWKFEPL LGEELDLRRV TWRLPPELIP 1400
RLSASSGRSD EDGSVAGGVE GEGSGWIRGA TPRPPGEHLV NGRMDFAYPG 1450
SANSLHRMTA ANVAYGTHLS PHLSHRVLST SSTLTRDYHS LTRTEHSHSG 1500
TLPRDYSTLT SLSSQDSRGA VGVPDTPTRL VFSALGPTSL KVSWQEPQCD 1550
RMLLGYSVEY QLLNGGEMHR LNIPNPGQTS VVVEDLLPNH SYVFRVRAQS 1600
QEGWGREREG VITIESQVHP QSPLCPLPGS AFTLSTPSAP GPLVFTALSP 1650
DSLQLSWERP RRPNGDILGY LVTCEMAQGG APARTFRVDG DNPESRLTVP 1700
GLSENVPYKF KVQARTTEGF GPEREGIITI ESQVGGPFPQ LGSHSGLFQN 1750
PVQSEFSSVT STHSTTTEPF LMDGLTLGTQ RLEAGGSLTR HVTQEFVTRT 1800
LTASGSLSTH MDQQFFQT 1818
Length:1,818
Mass (Da):201,650
Last modified:February 20, 2007 - v1
Checksum:iCA41A7E6B4E20B59
GO
Isoform 2 (identifier: A2A863-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1372-1436: Missing.

Show »
Length:1,753
Mass (Da):194,753
Checksum:i1417FAE0584640A5
GO
Isoform 3 (identifier: A2A863-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1372-1436: Missing.
     1515-1515: Q → QGLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRGSPDSIILAGQSAAPSWGT

Show »
Length:1,806
Mass (Da):200,261
Checksum:i89554C47CE0DC661
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1372 – 143665Missing in isoform 2 and isoform 3.
VSP_037636Add
BLAST
Alternative sequencei1515 – 15151Q → QGLPPIWEDGRSRLPLSWTL GSLSRAHMKGVPASRGSPDS IILAGQSAAPSWGT in isoform 3.
VSP_037637

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti17 – 171A → R1 Publication
Sequence conflicti67 – 682EL → DV1 Publication
Sequence conflicti94 – 941D → V1 Publication
Sequence conflicti113 – 1131P → R1 Publication
Sequence conflicti118 – 1181S → T1 Publication
Sequence conflicti624 – 6241Missing1 Publication
Sequence conflicti666 – 6661Missing1 Publication
Sequence conflicti709 – 7135PPGSF → LPAPS1 Publication
Sequence conflicti851 – 8511E → K in AAH59192. 1 Publication
Sequence conflicti877 – 8771T → A1 Publication
Sequence conflicti877 – 8771T → A in AAH06632. 1 Publication
Sequence conflicti877 – 8771T → A in AAH59192. 1 Publication
Sequence conflicti972 – 9721G → S1 Publication
Sequence conflicti1105 – 11073Missing1 Publication
Sequence conflicti1204 – 12041Q → K1 Publication
Sequence conflicti1292 – 12921E → D1 Publication
Sequence conflicti1537 – 15371P → R1 Publication
Sequence conflicti1552 – 15521M → T1 Publication
Sequence conflicti1552 – 15521M → T in AAH06632. 1 Publication
Sequence conflicti1552 – 15521M → T in AAH25194. 1 Publication
Sequence conflicti1552 – 15521M → T in AAH59192. 1 Publication
Sequence conflicti1564 – 15663NGG → TCV1 Publication
Sequence conflicti1590 – 15923HSY → YSH1 Publication
Sequence conflicti1653 – 16531L → P1 Publication
Sequence conflicti1662 – 16632RP → SR1 Publication
Sequence conflicti1744 – 17441H → N1 Publication
Sequence conflicti1759 – 17591V → M in AAH25194. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL607108, AL645647 Genomic DNA. Translation: CAM24050.1.
AL607108, AL645647 Genomic DNA. Translation: CAM24052.1.
AL607108, AL645647 Genomic DNA. Translation: CAM24053.1.
BC006632 mRNA. Translation: AAH06632.1.
BC025194 mRNA. Translation: AAH25194.1.
BC059192 mRNA. Translation: AAH59192.1.
PIRiJN0786.
RefSeqiXP_006532635.1. XM_006532572.1. [A2A863-1]
XP_006532636.1. XM_006532573.1. [A2A863-3]
XP_006532637.1. XM_006532574.1. [A2A863-2]
UniGeneiMm.213873.

Genome annotation databases

EnsembliENSMUST00000068981; ENSMUSP00000070811; ENSMUSG00000020758. [A2A863-2]
ENSMUST00000106458; ENSMUSP00000102066; ENSMUSG00000020758. [A2A863-1]
ENSMUST00000106460; ENSMUSP00000102068; ENSMUSG00000020758. [A2A863-3]
ENSMUST00000106461; ENSMUSP00000102069; ENSMUSG00000020758. [A2A863-1]
GeneIDi192897.
KEGGimmu:192897.
UCSCiuc007mji.1. mouse. [A2A863-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL607108 , AL645647 Genomic DNA. Translation: CAM24050.1 .
AL607108 , AL645647 Genomic DNA. Translation: CAM24052.1 .
AL607108 , AL645647 Genomic DNA. Translation: CAM24053.1 .
BC006632 mRNA. Translation: AAH06632.1 .
BC025194 mRNA. Translation: AAH25194.1 .
BC059192 mRNA. Translation: AAH59192.1 .
PIRi JN0786.
RefSeqi XP_006532635.1. XM_006532572.1. [A2A863-1 ]
XP_006532636.1. XM_006532573.1. [A2A863-3 ]
XP_006532637.1. XM_006532574.1. [A2A863-2 ]
UniGenei Mm.213873.

3D structure databases

ProteinModelPortali A2A863.
SMRi A2A863. Positions 29-711, 933-1111, 1128-1340, 1515-1746.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei A2A863.

Proteomic databases

MaxQBi A2A863.
PaxDbi A2A863.
PRIDEi A2A863.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000068981 ; ENSMUSP00000070811 ; ENSMUSG00000020758 . [A2A863-2 ]
ENSMUST00000106458 ; ENSMUSP00000102066 ; ENSMUSG00000020758 . [A2A863-1 ]
ENSMUST00000106460 ; ENSMUSP00000102068 ; ENSMUSG00000020758 . [A2A863-3 ]
ENSMUST00000106461 ; ENSMUSP00000102069 ; ENSMUSG00000020758 . [A2A863-1 ]
GeneIDi 192897.
KEGGi mmu:192897.
UCSCi uc007mji.1. mouse. [A2A863-2 ]

Organism-specific databases

CTDi 3691.
MGIi MGI:96613. Itgb4.

Phylogenomic databases

eggNOGi NOG303049.
GeneTreei ENSGT00730000110513.
HOGENOMi HOG000231105.
InParanoidi A2A863.
KOi K06525.
OMAi TIIKEQA.
OrthoDBi EOG7T7GSB.
PhylomeDBi A2A863.
TreeFami TF105392.

Enzyme and pathway databases

Reactomei REACT_202342. Laminin interactions.

Miscellaneous databases

ChiTaRSi ITGB4. mouse.
PROi A2A863.
SOURCEi Search...

Gene expression databases

ArrayExpressi A2A863.
Bgeei A2A863.
Genevestigatori A2A863.

Family and domain databases

Gene3Di 2.60.40.10. 4 hits.
3.40.50.410. 1 hit.
InterProi IPR003644. Calx_beta.
IPR013032. EGF-like_CS.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR015812. Integrin_bsu.
IPR012013. Integrin_bsu-4.
IPR002369. Integrin_bsu_N.
IPR012896. Integrin_bsu_tail.
IPR016201. Plexin-like_fold.
IPR002035. VWF_A.
[Graphical view ]
PANTHERi PTHR10082. PTHR10082. 1 hit.
PTHR10082:SF6. PTHR10082:SF6. 1 hit.
Pfami PF03160. Calx-beta. 1 hit.
PF00041. fn3. 4 hits.
PF07965. Integrin_B_tail. 1 hit.
PF00362. Integrin_beta. 1 hit.
[Graphical view ]
PIRSFi PIRSF002513. Integrin_B4. 1 hit.
PRINTSi PR01186. INTEGRINB.
SMARTi SM00237. Calx_beta. 1 hit.
SM00060. FN3. 4 hits.
SM00187. INB. 1 hit.
SM00423. PSI. 1 hit.
SM00327. VWA. 1 hit.
[Graphical view ]
SUPFAMi SSF103575. SSF103575. 1 hit.
SSF49265. SSF49265. 2 hits.
SSF53300. SSF53300. 1 hit.
SSF69687. SSF69687. 1 hit.
PROSITEi PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50853. FN3. 4 hits.
PS00243. INTEGRIN_BETA. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence of a cDNA encoding the beta 4 subunit of murine integrin."
    Kennel S.J., Foote L.J., Cimino L., Rizzo M.G., Chang L.Y., Sacchi A.
    Gene 130:209-216(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 124-1818 (ISOFORM 2).
    Strain: Czech II and FVB/N.
    Tissue: Mammary tumor.

Entry informationi

Entry nameiITB4_MOUSE
AccessioniPrimary (citable) accession number: A2A863
Secondary accession number(s): A2A865
, A2A866, Q6PCS0, Q8R3J1, Q91W15
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 7, 2009
Last sequence update: February 20, 2007
Last modified: September 3, 2014
This is version 77 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi