Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A2A863

- ITB4_MOUSE

UniProt

A2A863 - ITB4_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Integrin beta-4

Gene

Itgb4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility By similarity.By similarity

GO - Molecular functioni

  1. receptor activity Source: InterPro

GO - Biological processi

  1. autophagy Source: Ensembl
  2. cell adhesion Source: MGI
  3. cell-matrix adhesion Source: InterPro
  4. cell motility Source: UniProtKB
  5. filopodium assembly Source: MGI
  6. hemidesmosome assembly Source: Ensembl
  7. integrin-mediated signaling pathway Source: UniProtKB-KW
  8. multicellular organismal development Source: InterPro
  9. response to wounding Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Integrin, Receptor

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiREACT_202342. Laminin interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin beta-4
Alternative name(s):
CD_antigen: CD104
Gene namesi
Name:Itgb4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:96613. Itgb4.

Subcellular locationi

Cell membrane By similarity; Single-pass type I membrane protein By similarity. Cell membrane By similarity; Lipid-anchor By similarity. Cell junctionhemidesmosome By similarity
Note: Colocalizes with DST at the leading edge of migrating keratinocytes.By similarity

GO - Cellular componenti

  1. basal plasma membrane Source: MGI
  2. basement membrane Source: MGI
  3. cell leading edge Source: UniProtKB
  4. cell surface Source: Ensembl
  5. extracellular vesicular exosome Source: Ensembl
  6. hemidesmosome Source: MGI
  7. integrin complex Source: MGI
  8. receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2828By similarityAdd
BLAST
Chaini29 – 18181790Integrin beta-4PRO_0000379078Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi31 ↔ 457By similarity
Disulfide bondi39 ↔ 49By similarity
Disulfide bondi42 ↔ 73By similarity
Disulfide bondi52 ↔ 62By similarity
Disulfide bondi246 ↔ 289By similarity
Glycosylationi328 – 3281N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi425 ↔ 673By similarity
Disulfide bondi454 ↔ 459By similarity
Disulfide bondi470 ↔ 481By similarity
Disulfide bondi478 ↔ 514By similarity
Disulfide bondi483 ↔ 492By similarity
Glycosylationi493 – 4931N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi494 ↔ 505By similarity
Disulfide bondi520 ↔ 525By similarity
Disulfide bondi522 ↔ 553By similarity
Disulfide bondi527 ↔ 538By similarity
Disulfide bondi559 ↔ 564By similarity
Disulfide bondi566 ↔ 575By similarity
Disulfide bondi577 ↔ 584By similarity
Glycosylationi581 – 5811N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi598 ↔ 603By similarity
Disulfide bondi600 ↔ 650By similarity
Disulfide bondi605 ↔ 616By similarity
Glycosylationi619 – 6191N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi628 ↔ 637By similarity
Disulfide bondi634 ↔ 708By similarity
Disulfide bondi653 ↔ 682By similarity
Glycosylationi697 – 6971N-linked (GlcNAc...)Sequence Analysis
Modified residuei1526 – 15261PhosphothreonineBy similarity

Post-translational modificationi

Palmitoylated by DHHC3 at several cysteines of the membrane-proximal region, enhancing stability and cell surface expression. Palmitoylation also promotes secundary association with tertaspanins By similarity.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiA2A863.
PaxDbiA2A863.
PRIDEiA2A863.

PTM databases

PhosphoSiteiA2A863.

Expressioni

Gene expression databases

BgeeiA2A863.
ExpressionAtlasiA2A863. baseline and differential.
GenevestigatoriA2A863.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. Beta-4 associates with alpha-6. Interacts (via cytoplasmic region) with COL17A1 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST isoform 3 (via N-terminus). Interacts (via cytoplasmic domain) with DST (via N-terminus). Interacts with RAC1 By similarity.By similarity

Structurei

3D structure databases

ProteinModelPortaliA2A863.
SMRiA2A863. Positions 29-711, 933-1111, 1128-1340, 1515-1771.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini29 – 712684ExtracellularSequence AnalysisAdd
BLAST
Topological domaini734 – 18181085CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei713 – 73321HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini30 – 7445PSIAdd
BLAST
Domaini132 – 310179VWFAAdd
BLAST
Repeati458 – 50447IAdd
BLAST
Repeati505 – 54440IIAdd
BLAST
Repeati545 – 58339IIIAdd
BLAST
Repeati584 – 62138IVAdd
BLAST
Domaini981 – 1086106Calx-betaAdd
BLAST
Domaini1131 – 122090Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini1224 – 1323100Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Domaini1526 – 162196Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST
Domaini1639 – 173597Fibronectin type-III 4PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni458 – 621164Cysteine-rich tandem repeatsAdd
BLAST
Regioni734 – 75118Palmitoylated on several cysteinesBy similarityAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi473 – 4753Cell attachment siteSequence Analysis
Motifi1005 – 10073Cell attachment siteSequence Analysis

Domaini

The fibronectin type-III-like domains bind BPAG1 and plectin and probably also recruit BP230.By similarity

Sequence similaritiesi

Belongs to the integrin beta chain family.Curated
Contains 1 Calx-beta domain.Curated
Contains 4 fibronectin type-III domains.PROSITE-ProRule annotation
Contains 1 PSI domain.Curated
Contains 1 VWFA domain.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG303049.
GeneTreeiENSGT00760000119064.
HOGENOMiHOG000231105.
InParanoidiA2A863.
KOiK06525.
OMAiTIIKEQA.
OrthoDBiEOG7T7GSB.
PhylomeDBiA2A863.
TreeFamiTF105392.

Family and domain databases

Gene3Di2.60.40.10. 4 hits.
3.40.50.410. 1 hit.
InterProiIPR003644. Calx_beta.
IPR013032. EGF-like_CS.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR015812. Integrin_bsu.
IPR012013. Integrin_bsu-4.
IPR002369. Integrin_bsu_N.
IPR012896. Integrin_bsu_tail.
IPR016201. Plexin-like_fold.
IPR002035. VWF_A.
[Graphical view]
PANTHERiPTHR10082. PTHR10082. 1 hit.
PTHR10082:SF6. PTHR10082:SF6. 1 hit.
PfamiPF03160. Calx-beta. 1 hit.
PF00041. fn3. 4 hits.
PF07965. Integrin_B_tail. 1 hit.
PF00362. Integrin_beta. 1 hit.
[Graphical view]
PIRSFiPIRSF002513. Integrin_B4. 1 hit.
PRINTSiPR01186. INTEGRINB.
SMARTiSM00237. Calx_beta. 1 hit.
SM00060. FN3. 4 hits.
SM00187. INB. 1 hit.
SM00423. PSI. 1 hit.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMiSSF103575. SSF103575. 1 hit.
SSF49265. SSF49265. 2 hits.
SSF53300. SSF53300. 1 hit.
SSF69687. SSF69687. 1 hit.
PROSITEiPS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50853. FN3. 4 hits.
PS00243. INTEGRIN_BETA. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A2A863-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGPCCSPWV KLLLLAAMLS ASLPGDLANR CKKAQVKSCT ECIRVDKSCA
60 70 80 90 100
YCTDELFKER RCNTQAELLA AGCRGESILV MESSLEITEN TQIDTSLHRS
110 120 130 140 150
QVSPQGLQVR LRPGEERSFV FQVFEPLESP VDLYILMDFS NSMSDDLDNL
160 170 180 190 200
KQMGQNLAKI LRQLTSDYTI GFGKFVDKVS VPQTDMRPEK LKEPWPNSDP
210 220 230 240 250
PFSFKNVISL TENVEEFWNK LQGERISGNL DAPEGGFDAI LQTAVCTRDI
260 270 280 290 300
GWRADSTHLL VFSTESAFHY EADGANVLAG IMNRNDEKCH LDASGAYTQY
310 320 330 340 350
KTQDYPSVPT LVRLLAKHNI IPIFAVTNYS YSYYEKLHKY FPVSSLGVLQ
360 370 380 390 400
EDSSNIVELL EEAFYRIRSN LDIRALDSPR GLRTEVTSDT LQKTETGSFH
410 420 430 440 450
IKRGEVGTYN VHLRAVEDID GTHVCQLAKE DQGGNIHLKP SFSDGLRMDA
460 470 480 490 500
SVICDVCPCE LQKEVRSARC HFRGDFMCGH CVCNEGWSGK TCNCSTGSLS
510 520 530 540 550
DTQPCLREGE DKPCSGHGEC QCGRCVCYGE GRYEGHFCEY DNFQCPRTSG
560 570 580 590 600
FLCNDRGRCS MGECVCEPGW TGRSCDCPLS NATCIDSNGG ICNGRGYCEC
610 620 630 640 650
GRCHCNQQSL YTDTTCEINY SAIRLGLCED LRSCVQCQAW GTGEKKGRAC
660 670 680 690 700
DDCPFKVKMV DELKKAEEVV EYCSFRDEDD DCTYSYNVEG DGSPGPNSTV
710 720 730 740 750
LVHKKKDCPP GSFWWLIPLL IFLLLLLALL LLLCWKYCAC CKACLGLLPC
760 770 780 790 800
CNRGHMVGFK EDHYMLRENL MASDHLDTPM LRSGNLKGRD TVRWKITNNV
810 820 830 840 850
QRPGFATHAA STSPTELVPY GLSLRLGRLC TENLMKPGTR ECDQLRQEVE
860 870 880 890 900
ENLNEVYRQV SGAHKLQQTK FRQQPNTGKK QDHTIVDTVL LAPRSAKQML
910 920 930 940 950
LKLTEKQVEQ GSFHELKVAP GYYTVTAEQD ARGMVEFQEG VELVDVRVPL
960 970 980 990 1000
FIRPEDDDEK QLLVEAIDVP VGTATLGRRL VNITIIKEQA SGVVSFEQPE
1010 1020 1030 1040 1050
YSVSRGDQVA RIPVIRHILD NGKSQVSYST QDNTAHGHRD YVPVEGELLF
1060 1070 1080 1090 1100
HPGETWKELQ VKLLELQEVD SLLRGRQVRR FQVQLSNPKF GARLGQPSTT
1110 1120 1130 1140 1150
TVILGEHDET DRSLINQTLS SPPPPHGDLG APQNPNAKAA GSRKIHFNWL
1160 1170 1180 1190 1200
PPPGKPMGYR VKYWIQGDSE SEAHLLDSKV PSVELTNLYP YCDYEMKVCA
1210 1220 1230 1240 1250
YGAQGEGPYS SLVSCRTHQE VPSEPGRLAF NVVSSTVTQL SWAEPAETNG
1260 1270 1280 1290 1300
EITAYEVCYG LVNEDNRPIG PMKKVLVDNP KNRMLLIENL RESQPYRYTV
1310 1320 1330 1340 1350
KARNGAGWGP EREAIINLAT QPKRPMSIPI IPDIPIVDAQ GGEDYENFLM
1360 1370 1380 1390 1400
YSDDVLRSPA SSQRPSVSDD TGCGWKFEPL LGEELDLRRV TWRLPPELIP
1410 1420 1430 1440 1450
RLSASSGRSD EDGSVAGGVE GEGSGWIRGA TPRPPGEHLV NGRMDFAYPG
1460 1470 1480 1490 1500
SANSLHRMTA ANVAYGTHLS PHLSHRVLST SSTLTRDYHS LTRTEHSHSG
1510 1520 1530 1540 1550
TLPRDYSTLT SLSSQDSRGA VGVPDTPTRL VFSALGPTSL KVSWQEPQCD
1560 1570 1580 1590 1600
RMLLGYSVEY QLLNGGEMHR LNIPNPGQTS VVVEDLLPNH SYVFRVRAQS
1610 1620 1630 1640 1650
QEGWGREREG VITIESQVHP QSPLCPLPGS AFTLSTPSAP GPLVFTALSP
1660 1670 1680 1690 1700
DSLQLSWERP RRPNGDILGY LVTCEMAQGG APARTFRVDG DNPESRLTVP
1710 1720 1730 1740 1750
GLSENVPYKF KVQARTTEGF GPEREGIITI ESQVGGPFPQ LGSHSGLFQN
1760 1770 1780 1790 1800
PVQSEFSSVT STHSTTTEPF LMDGLTLGTQ RLEAGGSLTR HVTQEFVTRT
1810
LTASGSLSTH MDQQFFQT
Length:1,818
Mass (Da):201,650
Last modified:February 20, 2007 - v1
Checksum:iCA41A7E6B4E20B59
GO
Isoform 2 (identifier: A2A863-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1372-1436: Missing.

Show »
Length:1,753
Mass (Da):194,753
Checksum:i1417FAE0584640A5
GO
Isoform 3 (identifier: A2A863-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1372-1436: Missing.
     1515-1515: Q → QGLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRGSPDSIILAGQSAAPSWGT

Show »
Length:1,806
Mass (Da):200,261
Checksum:i89554C47CE0DC661
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti17 – 171A → R(PubMed:8359687)Curated
Sequence conflicti67 – 682EL → DV(PubMed:8359687)Curated
Sequence conflicti94 – 941D → V(PubMed:8359687)Curated
Sequence conflicti113 – 1131P → R(PubMed:8359687)Curated
Sequence conflicti118 – 1181S → T(PubMed:8359687)Curated
Sequence conflicti624 – 6241Missing(PubMed:8359687)Curated
Sequence conflicti666 – 6661Missing(PubMed:8359687)Curated
Sequence conflicti709 – 7135PPGSF → LPAPS(PubMed:8359687)Curated
Sequence conflicti851 – 8511E → K in AAH59192. (PubMed:15489334)Curated
Sequence conflicti877 – 8771T → A(PubMed:8359687)Curated
Sequence conflicti877 – 8771T → A in AAH06632. (PubMed:15489334)Curated
Sequence conflicti877 – 8771T → A in AAH59192. (PubMed:15489334)Curated
Sequence conflicti972 – 9721G → S(PubMed:8359687)Curated
Sequence conflicti1105 – 11073Missing(PubMed:8359687)Curated
Sequence conflicti1204 – 12041Q → K(PubMed:8359687)Curated
Sequence conflicti1292 – 12921E → D(PubMed:8359687)Curated
Sequence conflicti1537 – 15371P → R(PubMed:8359687)Curated
Sequence conflicti1552 – 15521M → T(PubMed:8359687)Curated
Sequence conflicti1552 – 15521M → T in AAH06632. (PubMed:15489334)Curated
Sequence conflicti1552 – 15521M → T in AAH25194. (PubMed:15489334)Curated
Sequence conflicti1552 – 15521M → T in AAH59192. (PubMed:15489334)Curated
Sequence conflicti1564 – 15663NGG → TCV(PubMed:8359687)Curated
Sequence conflicti1590 – 15923HSY → YSH(PubMed:8359687)Curated
Sequence conflicti1653 – 16531L → P(PubMed:8359687)Curated
Sequence conflicti1662 – 16632RP → SR(PubMed:8359687)Curated
Sequence conflicti1744 – 17441H → N(PubMed:8359687)Curated
Sequence conflicti1759 – 17591V → M in AAH25194. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1372 – 143665Missing in isoform 2 and isoform 3. 2 PublicationsVSP_037636Add
BLAST
Alternative sequencei1515 – 15151Q → QGLPPIWEDGRSRLPLSWTL GSLSRAHMKGVPASRGSPDS IILAGQSAAPSWGT in isoform 3. CuratedVSP_037637

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL607108, AL645647 Genomic DNA. Translation: CAM24050.1.
AL607108, AL645647 Genomic DNA. Translation: CAM24052.1.
AL607108, AL645647 Genomic DNA. Translation: CAM24053.1.
BC006632 mRNA. Translation: AAH06632.1.
BC025194 mRNA. Translation: AAH25194.1.
BC059192 mRNA. Translation: AAH59192.1.
PIRiJN0786.
RefSeqiXP_006532635.1. XM_006532572.1. [A2A863-1]
XP_006532636.1. XM_006532573.1. [A2A863-3]
XP_006532637.1. XM_006532574.1. [A2A863-2]
UniGeneiMm.213873.

Genome annotation databases

EnsembliENSMUST00000068981; ENSMUSP00000070811; ENSMUSG00000020758. [A2A863-2]
ENSMUST00000106458; ENSMUSP00000102066; ENSMUSG00000020758. [A2A863-1]
ENSMUST00000106460; ENSMUSP00000102068; ENSMUSG00000020758. [A2A863-3]
ENSMUST00000106461; ENSMUSP00000102069; ENSMUSG00000020758. [A2A863-1]
GeneIDi192897.
KEGGimmu:192897.
UCSCiuc007mji.1. mouse. [A2A863-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL607108 , AL645647 Genomic DNA. Translation: CAM24050.1 .
AL607108 , AL645647 Genomic DNA. Translation: CAM24052.1 .
AL607108 , AL645647 Genomic DNA. Translation: CAM24053.1 .
BC006632 mRNA. Translation: AAH06632.1 .
BC025194 mRNA. Translation: AAH25194.1 .
BC059192 mRNA. Translation: AAH59192.1 .
PIRi JN0786.
RefSeqi XP_006532635.1. XM_006532572.1. [A2A863-1 ]
XP_006532636.1. XM_006532573.1. [A2A863-3 ]
XP_006532637.1. XM_006532574.1. [A2A863-2 ]
UniGenei Mm.213873.

3D structure databases

ProteinModelPortali A2A863.
SMRi A2A863. Positions 29-711, 933-1111, 1128-1340, 1515-1771.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei A2A863.

Proteomic databases

MaxQBi A2A863.
PaxDbi A2A863.
PRIDEi A2A863.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000068981 ; ENSMUSP00000070811 ; ENSMUSG00000020758 . [A2A863-2 ]
ENSMUST00000106458 ; ENSMUSP00000102066 ; ENSMUSG00000020758 . [A2A863-1 ]
ENSMUST00000106460 ; ENSMUSP00000102068 ; ENSMUSG00000020758 . [A2A863-3 ]
ENSMUST00000106461 ; ENSMUSP00000102069 ; ENSMUSG00000020758 . [A2A863-1 ]
GeneIDi 192897.
KEGGi mmu:192897.
UCSCi uc007mji.1. mouse. [A2A863-2 ]

Organism-specific databases

CTDi 3691.
MGIi MGI:96613. Itgb4.

Phylogenomic databases

eggNOGi NOG303049.
GeneTreei ENSGT00760000119064.
HOGENOMi HOG000231105.
InParanoidi A2A863.
KOi K06525.
OMAi TIIKEQA.
OrthoDBi EOG7T7GSB.
PhylomeDBi A2A863.
TreeFami TF105392.

Enzyme and pathway databases

Reactomei REACT_202342. Laminin interactions.

Miscellaneous databases

ChiTaRSi ITGB4. mouse.
PROi A2A863.
SOURCEi Search...

Gene expression databases

Bgeei A2A863.
ExpressionAtlasi A2A863. baseline and differential.
Genevestigatori A2A863.

Family and domain databases

Gene3Di 2.60.40.10. 4 hits.
3.40.50.410. 1 hit.
InterProi IPR003644. Calx_beta.
IPR013032. EGF-like_CS.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR015812. Integrin_bsu.
IPR012013. Integrin_bsu-4.
IPR002369. Integrin_bsu_N.
IPR012896. Integrin_bsu_tail.
IPR016201. Plexin-like_fold.
IPR002035. VWF_A.
[Graphical view ]
PANTHERi PTHR10082. PTHR10082. 1 hit.
PTHR10082:SF6. PTHR10082:SF6. 1 hit.
Pfami PF03160. Calx-beta. 1 hit.
PF00041. fn3. 4 hits.
PF07965. Integrin_B_tail. 1 hit.
PF00362. Integrin_beta. 1 hit.
[Graphical view ]
PIRSFi PIRSF002513. Integrin_B4. 1 hit.
PRINTSi PR01186. INTEGRINB.
SMARTi SM00237. Calx_beta. 1 hit.
SM00060. FN3. 4 hits.
SM00187. INB. 1 hit.
SM00423. PSI. 1 hit.
SM00327. VWA. 1 hit.
[Graphical view ]
SUPFAMi SSF103575. SSF103575. 1 hit.
SSF49265. SSF49265. 2 hits.
SSF53300. SSF53300. 1 hit.
SSF69687. SSF69687. 1 hit.
PROSITEi PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50853. FN3. 4 hits.
PS00243. INTEGRIN_BETA. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence of a cDNA encoding the beta 4 subunit of murine integrin."
    Kennel S.J., Foote L.J., Cimino L., Rizzo M.G., Chang L.Y., Sacchi A.
    Gene 130:209-216(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 124-1818 (ISOFORM 2).
    Strain: Czech II and FVB/N.
    Tissue: Mammary tumor.

Entry informationi

Entry nameiITB4_MOUSE
AccessioniPrimary (citable) accession number: A2A863
Secondary accession number(s): A2A865
, A2A866, Q6PCS0, Q8R3J1, Q91W15
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 7, 2009
Last sequence update: February 20, 2007
Last modified: October 29, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3