Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin beta-4

Gene

Itgb4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility. ITGA6:ITGB4 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling. ITGA6:ITGB4 binds to IGF1 and this binding is essential for IGF1 signaling (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • amelogenesis Source: MGI
  • autophagy Source: MGI
  • cell adhesion Source: MGI
  • cell-matrix adhesion Source: MGI
  • cell motility Source: UniProtKB
  • digestive tract development Source: MGI
  • filopodium assembly Source: MGI
  • hemidesmosome assembly Source: MGI
  • integrin-mediated signaling pathway Source: UniProtKB-KW
  • nail development Source: MGI
  • renal system development Source: MGI
  • response to wounding Source: UniProtKB
  • skin development Source: MGI
  • trophoblast cell migration Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Integrin, Receptor

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiR-MMU-2022090. Assembly of collagen fibrils and other multimeric structures.
R-MMU-3000157. Laminin interactions.
R-MMU-446107. Type I hemidesmosome assembly.

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin beta-4
Alternative name(s):
CD_antigen: CD104
Gene namesi
Name:Itgb4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:96613. Itgb4.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini29 – 712ExtracellularSequence analysisAdd BLAST684
Transmembranei713 – 733HelicalSequence analysisAdd BLAST21
Topological domaini734 – 1818CytoplasmicSequence analysisAdd BLAST1085

GO - Cellular componenti

  • basal plasma membrane Source: MGI
  • basement membrane Source: MGI
  • cell junction Source: MGI
  • cell leading edge Source: UniProtKB
  • cell surface Source: MGI
  • extracellular exosome Source: MGI
  • hemidesmosome Source: MGI
  • integrin complex Source: MGI
  • nucleus Source: MGI
  • plasma membrane Source: MGI
  • receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 28By similarityAdd BLAST28
ChainiPRO_000037907829 – 1818Integrin beta-4Add BLAST1790

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi31 ↔ 457By similarity
Disulfide bondi39 ↔ 49By similarity
Disulfide bondi42 ↔ 73By similarity
Disulfide bondi52 ↔ 62By similarity
Disulfide bondi246 ↔ 289By similarity
Glycosylationi328N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi425 ↔ 673By similarity
Disulfide bondi454 ↔ 459By similarity
Disulfide bondi470 ↔ 481By similarity
Disulfide bondi478 ↔ 514By similarity
Disulfide bondi483 ↔ 492By similarity
Glycosylationi493N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi494 ↔ 505By similarity
Disulfide bondi520 ↔ 525By similarity
Disulfide bondi522 ↔ 553By similarity
Disulfide bondi527 ↔ 538By similarity
Disulfide bondi559 ↔ 564By similarity
Disulfide bondi566 ↔ 575By similarity
Disulfide bondi577 ↔ 584By similarity
Glycosylationi581N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi598 ↔ 603By similarity
Disulfide bondi600 ↔ 650By similarity
Disulfide bondi605 ↔ 616By similarity
Glycosylationi619N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi628 ↔ 637By similarity
Disulfide bondi634 ↔ 708By similarity
Disulfide bondi653 ↔ 682By similarity
Glycosylationi697N-linked (GlcNAc...)Sequence analysis1
Modified residuei773PhosphoserineBy similarity1
Modified residuei1071PhosphoserineCombined sources1
Modified residuei1121PhosphoserineBy similarity1
Modified residuei1451PhosphoserineBy similarity1
Modified residuei1454PhosphoserineBy similarity1
Modified residuei1470PhosphoserineCombined sources1
Modified residuei1483PhosphothreonineBy similarity1
Modified residuei1490PhosphoserineBy similarity1
Modified residuei1526PhosphothreonineBy similarity1
Modified residuei1787PhosphoserineBy similarity1

Post-translational modificationi

Palmitoylated by DHHC3 at several cysteines of the membrane-proximal region, enhancing stability and cell surface expression. Palmitoylation also promotes secundary association with tertaspanins (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiA2A863.
PeptideAtlasiA2A863.
PRIDEiA2A863.

PTM databases

iPTMnetiA2A863.
PhosphoSitePlusiA2A863.

Expressioni

Gene expression databases

BgeeiENSMUSG00000020758.
ExpressionAtlasiA2A863. baseline and differential.
GenevisibleiA2A863. MM.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. Beta-4 associates with alpha-6. Interacts (via cytoplasmic region) with COL17A1 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST isoform 3 (via N-terminus). Interacts (via cytoplasmic domain) with DST (via N-terminus). Interacts with RAC1. ITGA6:ITGB4 is found in a ternary complex with NRG1 and ERBB3. ITGA6:ITGB4 is found in a ternary complex with IGF1 and IGF1R (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi228715. 1 interactor.
IntActiA2A863. 1 interactor.

Structurei

3D structure databases

ProteinModelPortaliA2A863.
SMRiA2A863.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini30 – 74PSIAdd BLAST45
Domaini132 – 310VWFAAdd BLAST179
Repeati458 – 504IAdd BLAST47
Repeati505 – 544IIAdd BLAST40
Repeati545 – 583IIIAdd BLAST39
Repeati584 – 621IVAdd BLAST38
Domaini981 – 1086Calx-betaAdd BLAST106
Domaini1131 – 1220Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST90
Domaini1224 – 1323Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST100
Domaini1526 – 1621Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST96
Domaini1639 – 1735Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST97

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni195 – 200Involved in NRG1- and IGF1-bindingBy similarity6
Regioni458 – 621Cysteine-rich tandem repeatsAdd BLAST164
Regioni734 – 751Palmitoylated on several cysteinesBy similarityAdd BLAST18

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi473 – 475Cell attachment siteSequence analysis3
Motifi1005 – 1007Cell attachment siteSequence analysis3

Domaini

The fibronectin type-III-like domains bind BPAG1 and plectin and probably also recruit BP230.By similarity

Sequence similaritiesi

Belongs to the integrin beta chain family.Curated
Contains 1 Calx-beta domain.Curated
Contains 4 fibronectin type-III domains.PROSITE-ProRule annotation
Contains 1 PSI domain.Curated
Contains 1 VWFA domain.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000119064.
HOGENOMiHOG000231105.
InParanoidiA2A863.
OMAiEDDDCTY.
OrthoDBiEOG091G029W.
PhylomeDBiA2A863.
TreeFamiTF105392.

Family and domain databases

CDDicd00063. FN3. 4 hits.
Gene3Di2.60.40.10. 4 hits.
3.40.50.410. 1 hit.
InterProiIPR003644. Calx_beta.
IPR013032. EGF-like_CS.
IPR003961. FN3_dom.
IPR013783. Ig-like_fold.
IPR033760. Integin_beta_N.
IPR015812. Integrin_bsu.
IPR012013. Integrin_bsu-4.
IPR012896. Integrin_bsu_tail.
IPR002369. Integrin_bsu_VWA.
IPR002035. VWF_A.
[Graphical view]
PANTHERiPTHR10082. PTHR10082. 2 hits.
PTHR10082:SF42. PTHR10082:SF42. 2 hits.
PfamiPF03160. Calx-beta. 1 hit.
PF00041. fn3. 4 hits.
PF07965. Integrin_B_tail. 1 hit.
PF00362. Integrin_beta. 1 hit.
PF17205. PSI_integrin. 1 hit.
[Graphical view]
PIRSFiPIRSF002513. Integrin_B4. 1 hit.
PRINTSiPR01186. INTEGRINB.
SMARTiSM00237. Calx_beta. 1 hit.
SM00060. FN3. 4 hits.
SM00187. INB. 1 hit.
SM01242. Integrin_B_tail. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
SSF53300. SSF53300. 1 hit.
SSF69687. SSF69687. 1 hit.
PROSITEiPS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50853. FN3. 4 hits.
PS00243. INTEGRIN_BETA. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A2A863-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGPCCSPWV KLLLLAAMLS ASLPGDLANR CKKAQVKSCT ECIRVDKSCA
60 70 80 90 100
YCTDELFKER RCNTQAELLA AGCRGESILV MESSLEITEN TQIDTSLHRS
110 120 130 140 150
QVSPQGLQVR LRPGEERSFV FQVFEPLESP VDLYILMDFS NSMSDDLDNL
160 170 180 190 200
KQMGQNLAKI LRQLTSDYTI GFGKFVDKVS VPQTDMRPEK LKEPWPNSDP
210 220 230 240 250
PFSFKNVISL TENVEEFWNK LQGERISGNL DAPEGGFDAI LQTAVCTRDI
260 270 280 290 300
GWRADSTHLL VFSTESAFHY EADGANVLAG IMNRNDEKCH LDASGAYTQY
310 320 330 340 350
KTQDYPSVPT LVRLLAKHNI IPIFAVTNYS YSYYEKLHKY FPVSSLGVLQ
360 370 380 390 400
EDSSNIVELL EEAFYRIRSN LDIRALDSPR GLRTEVTSDT LQKTETGSFH
410 420 430 440 450
IKRGEVGTYN VHLRAVEDID GTHVCQLAKE DQGGNIHLKP SFSDGLRMDA
460 470 480 490 500
SVICDVCPCE LQKEVRSARC HFRGDFMCGH CVCNEGWSGK TCNCSTGSLS
510 520 530 540 550
DTQPCLREGE DKPCSGHGEC QCGRCVCYGE GRYEGHFCEY DNFQCPRTSG
560 570 580 590 600
FLCNDRGRCS MGECVCEPGW TGRSCDCPLS NATCIDSNGG ICNGRGYCEC
610 620 630 640 650
GRCHCNQQSL YTDTTCEINY SAIRLGLCED LRSCVQCQAW GTGEKKGRAC
660 670 680 690 700
DDCPFKVKMV DELKKAEEVV EYCSFRDEDD DCTYSYNVEG DGSPGPNSTV
710 720 730 740 750
LVHKKKDCPP GSFWWLIPLL IFLLLLLALL LLLCWKYCAC CKACLGLLPC
760 770 780 790 800
CNRGHMVGFK EDHYMLRENL MASDHLDTPM LRSGNLKGRD TVRWKITNNV
810 820 830 840 850
QRPGFATHAA STSPTELVPY GLSLRLGRLC TENLMKPGTR ECDQLRQEVE
860 870 880 890 900
ENLNEVYRQV SGAHKLQQTK FRQQPNTGKK QDHTIVDTVL LAPRSAKQML
910 920 930 940 950
LKLTEKQVEQ GSFHELKVAP GYYTVTAEQD ARGMVEFQEG VELVDVRVPL
960 970 980 990 1000
FIRPEDDDEK QLLVEAIDVP VGTATLGRRL VNITIIKEQA SGVVSFEQPE
1010 1020 1030 1040 1050
YSVSRGDQVA RIPVIRHILD NGKSQVSYST QDNTAHGHRD YVPVEGELLF
1060 1070 1080 1090 1100
HPGETWKELQ VKLLELQEVD SLLRGRQVRR FQVQLSNPKF GARLGQPSTT
1110 1120 1130 1140 1150
TVILGEHDET DRSLINQTLS SPPPPHGDLG APQNPNAKAA GSRKIHFNWL
1160 1170 1180 1190 1200
PPPGKPMGYR VKYWIQGDSE SEAHLLDSKV PSVELTNLYP YCDYEMKVCA
1210 1220 1230 1240 1250
YGAQGEGPYS SLVSCRTHQE VPSEPGRLAF NVVSSTVTQL SWAEPAETNG
1260 1270 1280 1290 1300
EITAYEVCYG LVNEDNRPIG PMKKVLVDNP KNRMLLIENL RESQPYRYTV
1310 1320 1330 1340 1350
KARNGAGWGP EREAIINLAT QPKRPMSIPI IPDIPIVDAQ GGEDYENFLM
1360 1370 1380 1390 1400
YSDDVLRSPA SSQRPSVSDD TGCGWKFEPL LGEELDLRRV TWRLPPELIP
1410 1420 1430 1440 1450
RLSASSGRSD EDGSVAGGVE GEGSGWIRGA TPRPPGEHLV NGRMDFAYPG
1460 1470 1480 1490 1500
SANSLHRMTA ANVAYGTHLS PHLSHRVLST SSTLTRDYHS LTRTEHSHSG
1510 1520 1530 1540 1550
TLPRDYSTLT SLSSQDSRGA VGVPDTPTRL VFSALGPTSL KVSWQEPQCD
1560 1570 1580 1590 1600
RMLLGYSVEY QLLNGGEMHR LNIPNPGQTS VVVEDLLPNH SYVFRVRAQS
1610 1620 1630 1640 1650
QEGWGREREG VITIESQVHP QSPLCPLPGS AFTLSTPSAP GPLVFTALSP
1660 1670 1680 1690 1700
DSLQLSWERP RRPNGDILGY LVTCEMAQGG APARTFRVDG DNPESRLTVP
1710 1720 1730 1740 1750
GLSENVPYKF KVQARTTEGF GPEREGIITI ESQVGGPFPQ LGSHSGLFQN
1760 1770 1780 1790 1800
PVQSEFSSVT STHSTTTEPF LMDGLTLGTQ RLEAGGSLTR HVTQEFVTRT
1810
LTASGSLSTH MDQQFFQT
Length:1,818
Mass (Da):201,650
Last modified:February 20, 2007 - v1
Checksum:iCA41A7E6B4E20B59
GO
Isoform 2 (identifier: A2A863-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1372-1436: Missing.

Show »
Length:1,753
Mass (Da):194,753
Checksum:i1417FAE0584640A5
GO
Isoform 3 (identifier: A2A863-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1372-1436: Missing.
     1515-1515: Q → QGLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRGSPDSIILAGQSAAPSWGT

Show »
Length:1,806
Mass (Da):200,261
Checksum:i89554C47CE0DC661
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti17A → R (PubMed:8359687).Curated1
Sequence conflicti67 – 68EL → DV (PubMed:8359687).Curated2
Sequence conflicti94D → V (PubMed:8359687).Curated1
Sequence conflicti113P → R (PubMed:8359687).Curated1
Sequence conflicti118S → T (PubMed:8359687).Curated1
Sequence conflicti624Missing (PubMed:8359687).Curated1
Sequence conflicti666Missing (PubMed:8359687).Curated1
Sequence conflicti709 – 713PPGSF → LPAPS (PubMed:8359687).Curated5
Sequence conflicti851E → K in AAH59192 (PubMed:15489334).Curated1
Sequence conflicti877T → A (PubMed:8359687).Curated1
Sequence conflicti877T → A in AAH06632 (PubMed:15489334).Curated1
Sequence conflicti877T → A in AAH59192 (PubMed:15489334).Curated1
Sequence conflicti972G → S (PubMed:8359687).Curated1
Sequence conflicti1105 – 1107Missing (PubMed:8359687).Curated3
Sequence conflicti1204Q → K (PubMed:8359687).Curated1
Sequence conflicti1292E → D (PubMed:8359687).Curated1
Sequence conflicti1537P → R (PubMed:8359687).Curated1
Sequence conflicti1552M → T (PubMed:8359687).Curated1
Sequence conflicti1552M → T in AAH06632 (PubMed:15489334).Curated1
Sequence conflicti1552M → T in AAH25194 (PubMed:15489334).Curated1
Sequence conflicti1552M → T in AAH59192 (PubMed:15489334).Curated1
Sequence conflicti1564 – 1566NGG → TCV (PubMed:8359687).Curated3
Sequence conflicti1590 – 1592HSY → YSH (PubMed:8359687).Curated3
Sequence conflicti1653L → P (PubMed:8359687).Curated1
Sequence conflicti1662 – 1663RP → SR (PubMed:8359687).Curated2
Sequence conflicti1744H → N (PubMed:8359687).Curated1
Sequence conflicti1759V → M in AAH25194 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0376361372 – 1436Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST65
Alternative sequenceiVSP_0376371515Q → QGLPPIWEDGRSRLPLSWTL GSLSRAHMKGVPASRGSPDS IILAGQSAAPSWGT in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL607108, AL645647 Genomic DNA. Translation: CAM24050.1.
AL607108, AL645647 Genomic DNA. Translation: CAM24052.1.
AL607108, AL645647 Genomic DNA. Translation: CAM24053.1.
BC006632 mRNA. Translation: AAH06632.1.
BC025194 mRNA. Translation: AAH25194.1.
BC059192 mRNA. Translation: AAH59192.1.
PIRiJN0786.
RefSeqiXP_006532635.1. XM_006532572.3. [A2A863-1]
XP_006532636.1. XM_006532573.3. [A2A863-3]
XP_006532637.1. XM_006532574.2. [A2A863-2]
UniGeneiMm.213873.

Genome annotation databases

EnsembliENSMUST00000068981; ENSMUSP00000070811; ENSMUSG00000020758. [A2A863-2]
ENSMUST00000106458; ENSMUSP00000102066; ENSMUSG00000020758. [A2A863-1]
ENSMUST00000106460; ENSMUSP00000102068; ENSMUSG00000020758. [A2A863-3]
ENSMUST00000106461; ENSMUSP00000102069; ENSMUSG00000020758. [A2A863-1]
GeneIDi192897.
UCSCiuc007mji.1. mouse. [A2A863-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL607108, AL645647 Genomic DNA. Translation: CAM24050.1.
AL607108, AL645647 Genomic DNA. Translation: CAM24052.1.
AL607108, AL645647 Genomic DNA. Translation: CAM24053.1.
BC006632 mRNA. Translation: AAH06632.1.
BC025194 mRNA. Translation: AAH25194.1.
BC059192 mRNA. Translation: AAH59192.1.
PIRiJN0786.
RefSeqiXP_006532635.1. XM_006532572.3. [A2A863-1]
XP_006532636.1. XM_006532573.3. [A2A863-3]
XP_006532637.1. XM_006532574.2. [A2A863-2]
UniGeneiMm.213873.

3D structure databases

ProteinModelPortaliA2A863.
SMRiA2A863.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi228715. 1 interactor.
IntActiA2A863. 1 interactor.

PTM databases

iPTMnetiA2A863.
PhosphoSitePlusiA2A863.

Proteomic databases

MaxQBiA2A863.
PeptideAtlasiA2A863.
PRIDEiA2A863.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000068981; ENSMUSP00000070811; ENSMUSG00000020758. [A2A863-2]
ENSMUST00000106458; ENSMUSP00000102066; ENSMUSG00000020758. [A2A863-1]
ENSMUST00000106460; ENSMUSP00000102068; ENSMUSG00000020758. [A2A863-3]
ENSMUST00000106461; ENSMUSP00000102069; ENSMUSG00000020758. [A2A863-1]
GeneIDi192897.
UCSCiuc007mji.1. mouse. [A2A863-2]

Organism-specific databases

CTDi3691.
MGIiMGI:96613. Itgb4.

Phylogenomic databases

GeneTreeiENSGT00760000119064.
HOGENOMiHOG000231105.
InParanoidiA2A863.
OMAiEDDDCTY.
OrthoDBiEOG091G029W.
PhylomeDBiA2A863.
TreeFamiTF105392.

Enzyme and pathway databases

ReactomeiR-MMU-2022090. Assembly of collagen fibrils and other multimeric structures.
R-MMU-3000157. Laminin interactions.
R-MMU-446107. Type I hemidesmosome assembly.

Miscellaneous databases

ChiTaRSiItgb4. mouse.
PROiA2A863.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020758.
ExpressionAtlasiA2A863. baseline and differential.
GenevisibleiA2A863. MM.

Family and domain databases

CDDicd00063. FN3. 4 hits.
Gene3Di2.60.40.10. 4 hits.
3.40.50.410. 1 hit.
InterProiIPR003644. Calx_beta.
IPR013032. EGF-like_CS.
IPR003961. FN3_dom.
IPR013783. Ig-like_fold.
IPR033760. Integin_beta_N.
IPR015812. Integrin_bsu.
IPR012013. Integrin_bsu-4.
IPR012896. Integrin_bsu_tail.
IPR002369. Integrin_bsu_VWA.
IPR002035. VWF_A.
[Graphical view]
PANTHERiPTHR10082. PTHR10082. 2 hits.
PTHR10082:SF42. PTHR10082:SF42. 2 hits.
PfamiPF03160. Calx-beta. 1 hit.
PF00041. fn3. 4 hits.
PF07965. Integrin_B_tail. 1 hit.
PF00362. Integrin_beta. 1 hit.
PF17205. PSI_integrin. 1 hit.
[Graphical view]
PIRSFiPIRSF002513. Integrin_B4. 1 hit.
PRINTSiPR01186. INTEGRINB.
SMARTiSM00237. Calx_beta. 1 hit.
SM00060. FN3. 4 hits.
SM00187. INB. 1 hit.
SM01242. Integrin_B_tail. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
SSF53300. SSF53300. 1 hit.
SSF69687. SSF69687. 1 hit.
PROSITEiPS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50853. FN3. 4 hits.
PS00243. INTEGRIN_BETA. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiITB4_MOUSE
AccessioniPrimary (citable) accession number: A2A863
Secondary accession number(s): A2A865
, A2A866, Q6PCS0, Q8R3J1, Q91W15
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 7, 2009
Last sequence update: February 20, 2007
Last modified: November 30, 2016
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.