A2A863 (ITB4_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 65.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Integrin beta-4 Alternative name(s): CD_antigen=CD104 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1818 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility By similarity. |
| Subunit structure | Heterodimer of an alpha and a beta subunit. Beta-4 associates with alpha-6. Interacts (via cytoplasmic region) with COL17A1 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST isoform 3 (via N-terminus). Interacts (via cytoplasmic domain) with DST (via N-terminus). Interacts with RAC1 By similarity. |
| Subcellular location | Membrane; Single-pass type I membrane protein By similarity. Cell junction › hemidesmosome By similarity. Note: Colocalizes with DST at the leading edge of migrating keratinocytes By similarity. |
| Domain | The fibronectin type-III-like domains bind BPAG1 and plectin and probably also recruit BP230 By similarity. |
| Sequence similarities | Belongs to the integrin beta chain family. Contains 1 Calx-beta domain. Contains 4 fibronectin type-III domains. Contains 1 PSI domain. Contains 1 VWFA domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A2A863-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A2A863-2) The sequence of this isoform differs from the canonical sequence as follows: 1372-1436: Missing. | ||||||
| Isoform 3 (identifier: A2A863-3) The sequence of this isoform differs from the canonical sequence as follows: 1372-1436: Missing. 1515-1515: Q → QGLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRGSPDSIILAGQSAAPSWGT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 28 | 28 | By similarity | ||||||||
| Chain | 29 – 1818 | 1790 | Integrin beta-4 | PRO_0000379078 | |||||||
Regions | |||||||||||
| Topological domain | 29 – 712 | 684 | Extracellular Potential | ||||||||
| Transmembrane | 713 – 733 | 21 | Helical; Potential | ||||||||
| Topological domain | 734 – 1818 | 1085 | Cytoplasmic Potential | ||||||||
| Domain | 30 – 74 | 45 | PSI | ||||||||
| Domain | 132 – 310 | 179 | VWFA | ||||||||
| Repeat | 458 – 504 | 47 | I | ||||||||
| Repeat | 505 – 544 | 40 | II | ||||||||
| Repeat | 545 – 583 | 39 | III | ||||||||
| Repeat | 584 – 621 | 38 | IV | ||||||||
| Domain | 981 – 1086 | 106 | Calx-beta | ||||||||
| Domain | 1128 – 1217 | 90 | Fibronectin type-III 1 | ||||||||
| Domain | 1222 – 1320 | 99 | Fibronectin type-III 2 | ||||||||
| Domain | 1524 – 1614 | 91 | Fibronectin type-III 3 | ||||||||
| Domain | 1637 – 1730 | 94 | Fibronectin type-III 4 | ||||||||
| Region | 458 – 621 | 164 | Cysteine-rich tandem repeats | ||||||||
| Motif | 473 – 475 | 3 | Cell attachment site Potential | ||||||||
| Motif | 1005 – 1007 | 3 | Cell attachment site Potential | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 1526 | 1 | Phosphothreonine By similarity | ||||||||
| Glycosylation | 328 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 493 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 581 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 619 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 697 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 31 ↔ 457 | By similarity | |||||||||
| Disulfide bond | 39 ↔ 49 | By similarity | |||||||||
| Disulfide bond | 42 ↔ 73 | By similarity | |||||||||
| Disulfide bond | 52 ↔ 62 | By similarity | |||||||||
| Disulfide bond | 246 ↔ 289 | By similarity | |||||||||
| Disulfide bond | 425 ↔ 673 | By similarity | |||||||||
| Disulfide bond | 454 ↔ 459 | By similarity | |||||||||
| Disulfide bond | 470 ↔ 481 | By similarity | |||||||||
| Disulfide bond | 478 ↔ 514 | By similarity | |||||||||
| Disulfide bond | 483 ↔ 492 | By similarity | |||||||||
| Disulfide bond | 494 ↔ 505 | By similarity | |||||||||
| Disulfide bond | 520 ↔ 525 | By similarity | |||||||||
| Disulfide bond | 522 ↔ 553 | By similarity | |||||||||
| Disulfide bond | 527 ↔ 538 | By similarity | |||||||||
| Disulfide bond | 559 ↔ 564 | By similarity | |||||||||
| Disulfide bond | 566 ↔ 575 | By similarity | |||||||||
| Disulfide bond | 577 ↔ 584 | By similarity | |||||||||
| Disulfide bond | 598 ↔ 603 | By similarity | |||||||||
| Disulfide bond | 600 ↔ 650 | By similarity | |||||||||
| Disulfide bond | 605 ↔ 616 | By similarity | |||||||||
| Disulfide bond | 628 ↔ 637 | By similarity | |||||||||
| Disulfide bond | 634 ↔ 708 | By similarity | |||||||||
| Disulfide bond | 653 ↔ 682 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1372 – 1436 | 65 | Missing in isoform 2 and isoform 3. | VSP_037636 | |||||||
| Alternative sequence | 1515 | 1 | Q → QGLPPIWEDGRSRLPLSWTL GSLSRAHMKGVPASRGSPDS IILAGQSAAPSWGT in isoform 3. | VSP_037637 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 17 | 1 | A → R Ref.1 | ||||||||
| Sequence conflict | 67 – 68 | 2 | EL → DV Ref.1 | ||||||||
| Sequence conflict | 94 | 1 | D → V Ref.1 | ||||||||
| Sequence conflict | 113 | 1 | P → R Ref.1 | ||||||||
| Sequence conflict | 118 | 1 | S → T Ref.1 | ||||||||
| Sequence conflict | 624 | 1 | Missing Ref.1 | ||||||||
| Sequence conflict | 666 | 1 | Missing Ref.1 | ||||||||
| Sequence conflict | 709 – 713 | 5 | PPGSF → LPAPS Ref.1 | ||||||||
| Sequence conflict | 851 | 1 | E → K in AAH59192. Ref.3 | ||||||||
| Sequence conflict | 877 | 1 | T → A Ref.1 | ||||||||
| Sequence conflict | 877 | 1 | T → A in AAH06632. Ref.3 | ||||||||
| Sequence conflict | 877 | 1 | T → A in AAH59192. Ref.3 | ||||||||
| Sequence conflict | 972 | 1 | G → S Ref.1 | ||||||||
| Sequence conflict | 1105 – 1107 | 3 | Missing Ref.1 | ||||||||
| Sequence conflict | 1204 | 1 | Q → K Ref.1 | ||||||||
| Sequence conflict | 1292 | 1 | E → D Ref.1 | ||||||||
| Sequence conflict | 1537 | 1 | P → R Ref.1 | ||||||||
| Sequence conflict | 1552 | 1 | M → T Ref.1 | ||||||||
| Sequence conflict | 1552 | 1 | M → T in AAH06632. Ref.3 | ||||||||
| Sequence conflict | 1552 | 1 | M → T in AAH25194. Ref.3 | ||||||||
| Sequence conflict | 1552 | 1 | M → T in AAH59192. Ref.3 | ||||||||
| Sequence conflict | 1564 – 1566 | 3 | NGG → TCV Ref.1 | ||||||||
| Sequence conflict | 1590 – 1592 | 3 | HSY → YSH Ref.1 | ||||||||
| Sequence conflict | 1653 | 1 | L → P Ref.1 | ||||||||
| Sequence conflict | 1662 – 1663 | 2 | RP → SR Ref.1 | ||||||||
| Sequence conflict | 1744 | 1 | H → N Ref.1 | ||||||||
| Sequence conflict | 1759 | 1 | V → M in AAH25194. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence of a cDNA encoding the beta 4 subunit of murine integrin." Kennel S.J., Foote L.J., Cimino L., Rizzo M.G., Chang L.Y., Sacchi A. Gene 130:209-216(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 124-1818 (ISOFORM 2). Strain: Czech II and FVB/N. Tissue: Mammary tumor. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL607108, AL645647 Genomic DNA. Translation: CAM24050.1. AL607108, AL645647 Genomic DNA. Translation: CAM24052.1. AL607108, AL645647 Genomic DNA. Translation: CAM24053.1. BC006632 mRNA. Translation: AAH06632.1. BC025194 mRNA. Translation: AAH25194.1. BC059192 mRNA. Translation: AAH59192.1. |
| IPI | IPI00313479. IPI00480458. IPI00649251. |
| PIR | JN0786. |
| UniGene | Mm.213873. |
3D structure databases | |
| ProteinModelPortal | A2A863. |
| SMR | A2A863. Positions 29-711, 933-1111, 1128-1340, 1515-1737. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | A2A863. |
Proteomic databases | |
| PaxDb | A2A863. |
| PRIDE | A2A863. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000068981; ENSMUSP00000070811; ENSMUSG00000020758. ENSMUST00000106458; ENSMUSP00000102066; ENSMUSG00000020758. ENSMUST00000106460; ENSMUSP00000102068; ENSMUSG00000020758. ENSMUST00000106461; ENSMUSP00000102069; ENSMUSG00000020758. |
| UCSC | uc007mji.1. mouse. |
Organism-specific databases | |
| MGI | MGI:96613. Itgb4. |
Phylogenomic databases | |
| eggNOG | NOG303049. |
| GeneTree | ENSGT00700000104058. |
| HOGENOM | HOG000231105. |
| InParanoid | A2A863. |
| OMA | EDDDCTY. |
Gene expression databases | |
| ArrayExpress | A2A863. |
| Bgee | A2A863. |
| Genevestigator | A2A863. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 4 hits. |
| InterPro | IPR003644. Calx_beta. IPR013032. EGF-like_CS. IPR003961. Fibronectin_type3. IPR013783. Ig-like_fold. IPR015812. Integrin_bsu. IPR012013. Integrin_bsu-4. IPR002369. Integrin_bsu_N. IPR012896. Integrin_bsu_tail. IPR003659. Plexin-like. IPR016201. Plexin-like_fold. IPR002035. VWF_A. [Graphical view] |
| PANTHER | PTHR10082. PTHR10082. 1 hit. PTHR10082:SF6. PTHR10082:SF6. 1 hit. |
| Pfam | PF03160. Calx-beta. 1 hit. PF00041. fn3. 4 hits. PF07965. Integrin_B_tail. 1 hit. PF00362. Integrin_beta. 1 hit. [Graphical view] |
| PIRSF | PIRSF002513. Integrin_B4. 1 hit. |
| PRINTS | PR01186. INTEGRINB. |
| SMART | SM00237. Calx_beta. 1 hit. SM00060. FN3. 4 hits. SM00187. INB. 1 hit. SM00423. PSI. 1 hit. SM00327. VWA. 1 hit. [Graphical view] |
| SUPFAM | SSF49265. FN_III-like. 4 hits. SSF69687. Integrin_bsu_tail. 1 hit. SSF103575. Plexin-like_fold. 1 hit. |
| PROSITE | PS00022. EGF_1. 2 hits. PS01186. EGF_2. 2 hits. Uncertain. PS50853. FN3. 4 hits. PS00243. INTEGRIN_BETA. 2 hits. PS50234. VWFA. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ITGB4. mouse. |
| SOURCE | Search... |
Entry information
| Entry name | ITB4_MOUSE | ||||||||
| Accession | Primary (citable) accession number: A2A863 Secondary accession number(s): A2A865 Q91W15 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
