A2A5D9 A2A5D9_MOUSE Orexin Hcrt Mus musculus Mouse Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Sciurognathi Muroidea Muridae Murinae Mus Mus NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] C57BL/6J IDENTIFICATION C57BL/6J The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. Complete proteome Reference proteome MNFPSTKVPWAAVTLLLLLLLPPALLSLGVDAQPLPDCCRQKTCSCRLYELLHGAGNHAA GILTLGKRRPGPPGLQGRLQRLLQANGTYTERSNTRAQSPPGKGWM Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License