Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A2A2Y4

- FRMD3_HUMAN

UniProt

A2A2Y4 - FRMD3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

FERM domain-containing protein 3

Gene

FRMD3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Putative tumor suppressor gene that may be implicated in the origin and progression of lung cancer.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
FERM domain-containing protein 3
Alternative name(s):
Band 4.1-like protein 4O
Ovary type protein 4.1
Short name:
4.1O
Gene namesi
Name:FRMD3
Synonyms:EPB41L4O
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:24125. FRMD3.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: InterPro
  2. cytoskeleton Source: InterPro
  3. extrinsic component of membrane Source: InterPro
  4. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134903920.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 597597FERM domain-containing protein 3PRO_0000318098Add
BLAST

Proteomic databases

MaxQBiA2A2Y4.
PaxDbiA2A2Y4.
PRIDEiA2A2Y4.

PTM databases

PhosphoSiteiA2A2Y4.

Expressioni

Tissue specificityi

Ovary-specific.1 Publication

Developmental stagei

Expressed in skeletal muscle, lower levels in thymus and brain.1 Publication

Gene expression databases

BgeeiA2A2Y4.
ExpressionAtlasiA2A2Y4. baseline and differential.
GenevestigatoriA2A2Y4.

Organism-specific databases

HPAiHPA017285.

Interactioni

Protein-protein interaction databases

IntActiA2A2Y4. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliA2A2Y4.
SMRiA2A2Y4. Positions 30-309.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei531 – 55121HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini32 – 312281FERMPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 FERM domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG331698.
GeneTreeiENSGT00760000118823.
HOVERGENiHBG057180.
InParanoidiA2A2Y4.
OMAiFLCEIRQ.
OrthoDBiEOG7M98FW.
PhylomeDBiA2A2Y4.
TreeFamiTF343477.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR019749. Band_41_domain.
IPR019750. Band_41_fam.
IPR000798. Ez/rad/moesin_like.
IPR014847. FERM-adjacent.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
IPR019748. FERM_central.
IPR019747. FERM_CS.
IPR000299. FERM_domain.
IPR018979. FERM_N.
IPR018980. FERM_PH-like_C.
IPR011993. PH_like_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF08736. FA. 1 hit.
PF09380. FERM_C. 1 hit.
PF00373. FERM_M. 1 hit.
PF09379. FERM_N. 1 hit.
[Graphical view]
PRINTSiPR00935. BAND41.
PR00661. ERMFAMILY.
SMARTiSM00295. B41. 1 hit.
[Graphical view]
SUPFAMiSSF47031. SSF47031. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS00660. FERM_1. 1 hit.
PS50057. FERM_3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A2A2Y4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFASCHCVPR GRRTMKMIHF RSSSVKSLSQ EMRCTIRLLD DSEISCHIQR
60 70 80 90 100
ETKGQFLIDH ICNYYSLLEK DYFGIRYVDP EKQRHWLEPN KSIFKQMKTH
110 120 130 140 150
PPYTMCFRVK FYPHEPLKIK EELTRYLLYL QIKRDIFHGR LLCSFSDAAY
160 170 180 190 200
LGACIVQAEL GDYDPDEHPE NYISEFEIFP KQSQKLERKI VEIHKNELRG
210 220 230 240 250
QSPPVAEFNL LLKAHTLETY GVDPHPCKDS TGTTTFLGFT AAGFVVFQGN
260 270 280 290 300
KRIHLIKWPD VCKLKFEGKT FYVIGTQKEK KAMLAFHTST PAACKHLWKC
310 320 330 340 350
GVENQAFYKY AKSSQIKTVS SSKIFFKGSR FRYSGKVAKE VVEASSKIQR
360 370 380 390 400
EPPEVHRANI TQSRSSHSLN KQLIINMEPL QPLLPSPSEQ EEELPLGEGV
410 420 430 440 450
PLPKEENISA PLISSSPVKA AREYEDPPSE EEDKIKEEPL TISELVYNPS
460 470 480 490 500
ASLLPTPVDD DEIDMLFDCP SRLELEREDT DSFEDLEADE NAFLIAEEEE
510 520 530 540 550
LKEARRALSW SYDILTGHIR VNPLVKSFSR LLVVGLGLLL FVFPLLLLLL
560 570 580 590
ESGIDLSFLC EIRQTPEFEQ FHYEYYCPLK EWVAGKVHLI LYMLGCS
Length:597
Mass (Da):68,772
Last modified:February 20, 2007 - v1
Checksum:i0B11ABBDDDE0AE67
GO
Isoform 2 (identifier: A2A2Y4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     553-597: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS → VSMQ

Show »
Length:556
Mass (Da):63,864
Checksum:iCD62C83272419CC6
GO
Isoform 3 (identifier: A2A2Y4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-194: Missing.
     195-198: KNEL → MVFR
     553-597: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS → VSMQ

Show »
Length:362
Mass (Da):40,685
Checksum:iB91E6436B98ECC42
GO
Isoform 4 (identifier: A2A2Y4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-344: Missing.
     345-398: SSKIQREPPE...EQEEELPLGE → MQAEETKGIG...LGSKVTARNT
     553-597: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS → VSMQ

Note: No experimental confirmation available.

Show »
Length:213
Mass (Da):23,923
Checksum:iBEAE61103185D1D1
GO
Isoform 5 (identifier: A2A2Y4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQ → MQLSK

Show »
Length:553
Mass (Da):63,664
Checksum:i38AD8ADC22D97EE8
GO

Sequence cautioni

The sequence BAC04321.1 differs from that shown. Reason: Erroneous initiation.
The sequence EAW62650.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti248 – 2481Q → R in AAN52119. (PubMed:12601556)Curated
Sequence conflicti554 – 5541I → V in AAN52119. (PubMed:12601556)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti485 – 4851D → Y.
Corresponds to variant rs4877747 [ dbSNP | Ensembl ].
VAR_048366

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 344344Missing in isoform 4. 1 PublicationVSP_031162Add
BLAST
Alternative sequencei1 – 194194Missing in isoform 3. 1 PublicationVSP_031163Add
BLAST
Alternative sequencei1 – 4949MFASC…SCHIQ → MQLSK in isoform 5. 1 PublicationVSP_031164Add
BLAST
Alternative sequencei195 – 1984KNEL → MVFR in isoform 3. 1 PublicationVSP_031165
Alternative sequencei345 – 39854SSKIQ…LPLGE → MQAEETKGIGITSMAKCLVK IQTRRSLQLHMVNHCNSNVF VRLLRLGSKVTARNT in isoform 4. 1 PublicationVSP_031166Add
BLAST
Alternative sequencei553 – 59745GIDLS…MLGCS → VSMQ in isoform 2, isoform 3 and isoform 4. 2 PublicationsVSP_031167Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY137774 mRNA. Translation: AAN52119.1.
AK094281 mRNA. Translation: BAC04321.1. Different initiation.
AK297722 mRNA. Translation: BAG60076.1.
EF560742 mRNA. Translation: ABQ59052.1.
AL161786, AL137847 Genomic DNA. Translation: CAH72749.1.
AL161786, AL137847, AL450026 Genomic DNA. Translation: CAH72750.2.
AL137847, AL161786 Genomic DNA. Translation: CAI40734.1.
AL137847, AL161786, AL450026 Genomic DNA. Translation: CAI40735.2.
AL137847 Genomic DNA. Translation: CAI40736.1.
AL161786, AL137847, AL450026 Genomic DNA. Translation: CAM17460.1.
AL450026, AL137847, AL161786 Genomic DNA. Translation: CAM19643.1.
AL450026, AL137847, AL161786 Genomic DNA. Translation: CAM19644.1.
AL137847, AL161786, AL450026 Genomic DNA. Translation: CAM19673.1.
CH471089 Genomic DNA. Translation: EAW62647.1.
CH471089 Genomic DNA. Translation: EAW62649.1.
CH471089 Genomic DNA. Translation: EAW62650.1. Different initiation.
CH471089 Genomic DNA. Translation: EAW62651.1.
BC023560 mRNA. Translation: AAH23560.1.
BC037253 mRNA. Translation: AAH37253.1.
AK223597 mRNA. Translation: BAD97317.1.
CCDSiCCDS43840.1. [A2A2Y4-1]
CCDS59131.1. [A2A2Y4-4]
CCDS59132.1. [A2A2Y4-3]
CCDS59133.1. [A2A2Y4-2]
CCDS75852.1. [A2A2Y4-5]
RefSeqiNP_001231888.1. NM_001244959.1. [A2A2Y4-2]
NP_001231889.1. NM_001244960.1. [A2A2Y4-5]
NP_001231890.1. NM_001244961.1. [A2A2Y4-3]
NP_001231891.1. NM_001244962.1. [A2A2Y4-4]
NP_777598.3. NM_174938.5. [A2A2Y4-1]
UniGeneiHs.127535.
Hs.743606.

Genome annotation databases

EnsembliENST00000304195; ENSP00000303508; ENSG00000172159. [A2A2Y4-1]
ENST00000328788; ENSP00000328615; ENSG00000172159. [A2A2Y4-4]
ENST00000376434; ENSP00000365617; ENSG00000172159. [A2A2Y4-3]
ENST00000376438; ENSP00000365621; ENSG00000172159. [A2A2Y4-2]
ENST00000621208; ENSP00000484839; ENSG00000172159. [A2A2Y4-5]
GeneIDi257019.
KEGGihsa:257019.
UCSCiuc004amq.1. human. [A2A2Y4-4]
uc004amr.1. human. [A2A2Y4-2]
uc004ams.2. human. [A2A2Y4-1]
uc022biz.1. human. [A2A2Y4-3]
uc022bja.1. human. [A2A2Y4-5]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY137774 mRNA. Translation: AAN52119.1 .
AK094281 mRNA. Translation: BAC04321.1 . Different initiation.
AK297722 mRNA. Translation: BAG60076.1 .
EF560742 mRNA. Translation: ABQ59052.1 .
AL161786 , AL137847 Genomic DNA. Translation: CAH72749.1 .
AL161786 , AL137847 , AL450026 Genomic DNA. Translation: CAH72750.2 .
AL137847 , AL161786 Genomic DNA. Translation: CAI40734.1 .
AL137847 , AL161786 , AL450026 Genomic DNA. Translation: CAI40735.2 .
AL137847 Genomic DNA. Translation: CAI40736.1 .
AL161786 , AL137847 , AL450026 Genomic DNA. Translation: CAM17460.1 .
AL450026 , AL137847 , AL161786 Genomic DNA. Translation: CAM19643.1 .
AL450026 , AL137847 , AL161786 Genomic DNA. Translation: CAM19644.1 .
AL137847 , AL161786 , AL450026 Genomic DNA. Translation: CAM19673.1 .
CH471089 Genomic DNA. Translation: EAW62647.1 .
CH471089 Genomic DNA. Translation: EAW62649.1 .
CH471089 Genomic DNA. Translation: EAW62650.1 . Different initiation.
CH471089 Genomic DNA. Translation: EAW62651.1 .
BC023560 mRNA. Translation: AAH23560.1 .
BC037253 mRNA. Translation: AAH37253.1 .
AK223597 mRNA. Translation: BAD97317.1 .
CCDSi CCDS43840.1. [A2A2Y4-1 ]
CCDS59131.1. [A2A2Y4-4 ]
CCDS59132.1. [A2A2Y4-3 ]
CCDS59133.1. [A2A2Y4-2 ]
CCDS75852.1. [A2A2Y4-5 ]
RefSeqi NP_001231888.1. NM_001244959.1. [A2A2Y4-2 ]
NP_001231889.1. NM_001244960.1. [A2A2Y4-5 ]
NP_001231890.1. NM_001244961.1. [A2A2Y4-3 ]
NP_001231891.1. NM_001244962.1. [A2A2Y4-4 ]
NP_777598.3. NM_174938.5. [A2A2Y4-1 ]
UniGenei Hs.127535.
Hs.743606.

3D structure databases

ProteinModelPortali A2A2Y4.
SMRi A2A2Y4. Positions 30-309.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi A2A2Y4. 3 interactions.

PTM databases

PhosphoSitei A2A2Y4.

Proteomic databases

MaxQBi A2A2Y4.
PaxDbi A2A2Y4.
PRIDEi A2A2Y4.

Protocols and materials databases

DNASUi 257019.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000304195 ; ENSP00000303508 ; ENSG00000172159 . [A2A2Y4-1 ]
ENST00000328788 ; ENSP00000328615 ; ENSG00000172159 . [A2A2Y4-4 ]
ENST00000376434 ; ENSP00000365617 ; ENSG00000172159 . [A2A2Y4-3 ]
ENST00000376438 ; ENSP00000365621 ; ENSG00000172159 . [A2A2Y4-2 ]
ENST00000621208 ; ENSP00000484839 ; ENSG00000172159 . [A2A2Y4-5 ]
GeneIDi 257019.
KEGGi hsa:257019.
UCSCi uc004amq.1. human. [A2A2Y4-4 ]
uc004amr.1. human. [A2A2Y4-2 ]
uc004ams.2. human. [A2A2Y4-1 ]
uc022biz.1. human. [A2A2Y4-3 ]
uc022bja.1. human. [A2A2Y4-5 ]

Organism-specific databases

CTDi 257019.
GeneCardsi GC09M085857.
H-InvDB HIX0023043.
HGNCi HGNC:24125. FRMD3.
HPAi HPA017285.
MIMi 607619. gene.
neXtProti NX_A2A2Y4.
PharmGKBi PA134903920.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG331698.
GeneTreei ENSGT00760000118823.
HOVERGENi HBG057180.
InParanoidi A2A2Y4.
OMAi FLCEIRQ.
OrthoDBi EOG7M98FW.
PhylomeDBi A2A2Y4.
TreeFami TF343477.

Miscellaneous databases

GenomeRNAii 257019.
NextBioi 92903.
PROi A2A2Y4.
SOURCEi Search...

Gene expression databases

Bgeei A2A2Y4.
ExpressionAtlasi A2A2Y4. baseline and differential.
Genevestigatori A2A2Y4.

Family and domain databases

Gene3Di 1.20.80.10. 1 hit.
2.30.29.30. 1 hit.
InterProi IPR019749. Band_41_domain.
IPR019750. Band_41_fam.
IPR000798. Ez/rad/moesin_like.
IPR014847. FERM-adjacent.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
IPR019748. FERM_central.
IPR019747. FERM_CS.
IPR000299. FERM_domain.
IPR018979. FERM_N.
IPR018980. FERM_PH-like_C.
IPR011993. PH_like_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view ]
Pfami PF08736. FA. 1 hit.
PF09380. FERM_C. 1 hit.
PF00373. FERM_M. 1 hit.
PF09379. FERM_N. 1 hit.
[Graphical view ]
PRINTSi PR00935. BAND41.
PR00661. ERMFAMILY.
SMARTi SM00295. B41. 1 hit.
[Graphical view ]
SUPFAMi SSF47031. SSF47031. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEi PS00660. FERM_1. 1 hit.
PS50057. FERM_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of the protein 4.1O gene, a novel member of the protein 4.1 family with focal expression in ovary."
    Ni X., Ji C., Cao G., Cheng H., Guo L., Gu S., Ying K., Zhao R.C., Mao Y.
    J. Hum. Genet. 48:101-106(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Fetal brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 34-597 (ISOFORM 2).
    Tissue: Cerebellum.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Brain and Placenta.
  7. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-597 (ISOFORM 1).
    Tissue: Kidney.
  8. Cited for: FUNCTION.

Entry informationi

Entry nameiFRMD3_HUMAN
AccessioniPrimary (citable) accession number: A2A2Y4
Secondary accession number(s): A8MQB0
, B4DN14, Q53EP2, Q5JV59, Q5VZA1, Q86WP8, Q8IZ44, Q8N3Y5, Q8N9L2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 20, 2007
Last modified: October 29, 2014
This is version 75 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3