Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A2A2Y4

- FRMD3_HUMAN

UniProt

A2A2Y4 - FRMD3_HUMAN

Protein

FERM domain-containing protein 3

Gene

FRMD3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 74 (01 Oct 2014)
      Sequence version 1 (20 Feb 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Putative tumor suppressor gene that may be implicated in the origin and progression of lung cancer.1 Publication

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    FERM domain-containing protein 3
    Alternative name(s):
    Band 4.1-like protein 4O
    Ovary type protein 4.1
    Short name:
    4.1O
    Gene namesi
    Name:FRMD3
    Synonyms:EPB41L4O
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:24125. FRMD3.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: InterPro
    2. cytoskeleton Source: InterPro
    3. extrinsic component of membrane Source: InterPro
    4. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134903920.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 597597FERM domain-containing protein 3PRO_0000318098Add
    BLAST

    Proteomic databases

    MaxQBiA2A2Y4.
    PaxDbiA2A2Y4.
    PRIDEiA2A2Y4.

    PTM databases

    PhosphoSiteiA2A2Y4.

    Expressioni

    Tissue specificityi

    Ovary-specific.1 Publication

    Developmental stagei

    Expressed in skeletal muscle, lower levels in thymus and brain.1 Publication

    Gene expression databases

    ArrayExpressiA2A2Y4.
    BgeeiA2A2Y4.
    GenevestigatoriA2A2Y4.

    Organism-specific databases

    HPAiHPA017285.

    Interactioni

    Protein-protein interaction databases

    IntActiA2A2Y4. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliA2A2Y4.
    SMRiA2A2Y4. Positions 30-309.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei531 – 55121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini32 – 312281FERMPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 FERM domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG331698.
    HOVERGENiHBG057180.
    InParanoidiA2A2Y4.
    OMAiFLCEIRQ.
    OrthoDBiEOG7M98FW.
    PhylomeDBiA2A2Y4.
    TreeFamiTF343477.

    Family and domain databases

    Gene3Di1.20.80.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProiIPR019749. Band_41_domain.
    IPR019750. Band_41_fam.
    IPR000798. Ez/rad/moesin_like.
    IPR014847. FERM-adjacent.
    IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
    IPR019748. FERM_central.
    IPR019747. FERM_CS.
    IPR000299. FERM_domain.
    IPR018979. FERM_N.
    IPR018980. FERM_PH-like_C.
    IPR011993. PH_like_dom.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view]
    PfamiPF08736. FA. 1 hit.
    PF09380. FERM_C. 1 hit.
    PF00373. FERM_M. 1 hit.
    PF09379. FERM_N. 1 hit.
    [Graphical view]
    PRINTSiPR00935. BAND41.
    PR00661. ERMFAMILY.
    SMARTiSM00295. B41. 1 hit.
    [Graphical view]
    SUPFAMiSSF47031. SSF47031. 1 hit.
    SSF54236. SSF54236. 1 hit.
    PROSITEiPS00660. FERM_1. 1 hit.
    PS50057. FERM_3. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A2A2Y4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFASCHCVPR GRRTMKMIHF RSSSVKSLSQ EMRCTIRLLD DSEISCHIQR    50
    ETKGQFLIDH ICNYYSLLEK DYFGIRYVDP EKQRHWLEPN KSIFKQMKTH 100
    PPYTMCFRVK FYPHEPLKIK EELTRYLLYL QIKRDIFHGR LLCSFSDAAY 150
    LGACIVQAEL GDYDPDEHPE NYISEFEIFP KQSQKLERKI VEIHKNELRG 200
    QSPPVAEFNL LLKAHTLETY GVDPHPCKDS TGTTTFLGFT AAGFVVFQGN 250
    KRIHLIKWPD VCKLKFEGKT FYVIGTQKEK KAMLAFHTST PAACKHLWKC 300
    GVENQAFYKY AKSSQIKTVS SSKIFFKGSR FRYSGKVAKE VVEASSKIQR 350
    EPPEVHRANI TQSRSSHSLN KQLIINMEPL QPLLPSPSEQ EEELPLGEGV 400
    PLPKEENISA PLISSSPVKA AREYEDPPSE EEDKIKEEPL TISELVYNPS 450
    ASLLPTPVDD DEIDMLFDCP SRLELEREDT DSFEDLEADE NAFLIAEEEE 500
    LKEARRALSW SYDILTGHIR VNPLVKSFSR LLVVGLGLLL FVFPLLLLLL 550
    ESGIDLSFLC EIRQTPEFEQ FHYEYYCPLK EWVAGKVHLI LYMLGCS 597
    Length:597
    Mass (Da):68,772
    Last modified:February 20, 2007 - v1
    Checksum:i0B11ABBDDDE0AE67
    GO
    Isoform 2 (identifier: A2A2Y4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         553-597: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS → VSMQ

    Show »
    Length:556
    Mass (Da):63,864
    Checksum:iCD62C83272419CC6
    GO
    Isoform 3 (identifier: A2A2Y4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-194: Missing.
         195-198: KNEL → MVFR
         553-597: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS → VSMQ

    Show »
    Length:362
    Mass (Da):40,685
    Checksum:iB91E6436B98ECC42
    GO
    Isoform 4 (identifier: A2A2Y4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-344: Missing.
         345-398: SSKIQREPPE...EQEEELPLGE → MQAEETKGIG...LGSKVTARNT
         553-597: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS → VSMQ

    Note: No experimental confirmation available.

    Show »
    Length:213
    Mass (Da):23,923
    Checksum:iBEAE61103185D1D1
    GO
    Isoform 5 (identifier: A2A2Y4-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-49: MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQ → MQLSK

    Show »
    Length:553
    Mass (Da):63,664
    Checksum:i38AD8ADC22D97EE8
    GO

    Sequence cautioni

    The sequence BAC04321.1 differs from that shown. Reason: Erroneous initiation.
    The sequence EAW62650.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti248 – 2481Q → R in AAN52119. (PubMed:12601556)Curated
    Sequence conflicti554 – 5541I → V in AAN52119. (PubMed:12601556)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti485 – 4851D → Y.
    Corresponds to variant rs4877747 [ dbSNP | Ensembl ].
    VAR_048366

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 344344Missing in isoform 4. 1 PublicationVSP_031162Add
    BLAST
    Alternative sequencei1 – 194194Missing in isoform 3. 1 PublicationVSP_031163Add
    BLAST
    Alternative sequencei1 – 4949MFASC…SCHIQ → MQLSK in isoform 5. 1 PublicationVSP_031164Add
    BLAST
    Alternative sequencei195 – 1984KNEL → MVFR in isoform 3. 1 PublicationVSP_031165
    Alternative sequencei345 – 39854SSKIQ…LPLGE → MQAEETKGIGITSMAKCLVK IQTRRSLQLHMVNHCNSNVF VRLLRLGSKVTARNT in isoform 4. 1 PublicationVSP_031166Add
    BLAST
    Alternative sequencei553 – 59745GIDLS…MLGCS → VSMQ in isoform 2, isoform 3 and isoform 4. 2 PublicationsVSP_031167Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY137774 mRNA. Translation: AAN52119.1.
    AK094281 mRNA. Translation: BAC04321.1. Different initiation.
    AK297722 mRNA. Translation: BAG60076.1.
    EF560742 mRNA. Translation: ABQ59052.1.
    AL161786, AL137847 Genomic DNA. Translation: CAH72749.1.
    AL161786, AL137847, AL450026 Genomic DNA. Translation: CAH72750.2.
    AL137847, AL161786 Genomic DNA. Translation: CAI40734.1.
    AL137847, AL161786, AL450026 Genomic DNA. Translation: CAI40735.2.
    AL137847 Genomic DNA. Translation: CAI40736.1.
    AL161786, AL137847, AL450026 Genomic DNA. Translation: CAM17460.1.
    AL450026, AL137847, AL161786 Genomic DNA. Translation: CAM19643.1.
    AL450026, AL137847, AL161786 Genomic DNA. Translation: CAM19644.1.
    AL137847, AL161786, AL450026 Genomic DNA. Translation: CAM19673.1.
    CH471089 Genomic DNA. Translation: EAW62647.1.
    CH471089 Genomic DNA. Translation: EAW62649.1.
    CH471089 Genomic DNA. Translation: EAW62650.1. Different initiation.
    CH471089 Genomic DNA. Translation: EAW62651.1.
    BC023560 mRNA. Translation: AAH23560.1.
    BC037253 mRNA. Translation: AAH37253.1.
    AK223597 mRNA. Translation: BAD97317.1.
    CCDSiCCDS43840.1. [A2A2Y4-1]
    CCDS59131.1. [A2A2Y4-4]
    CCDS59132.1. [A2A2Y4-3]
    CCDS59133.1. [A2A2Y4-2]
    RefSeqiNP_001231888.1. NM_001244959.1. [A2A2Y4-2]
    NP_001231889.1. NM_001244960.1. [A2A2Y4-5]
    NP_001231890.1. NM_001244961.1. [A2A2Y4-3]
    NP_001231891.1. NM_001244962.1. [A2A2Y4-4]
    NP_777598.3. NM_174938.5. [A2A2Y4-1]
    UniGeneiHs.127535.
    Hs.743606.

    Genome annotation databases

    EnsembliENST00000304195; ENSP00000303508; ENSG00000172159. [A2A2Y4-1]
    ENST00000328788; ENSP00000328615; ENSG00000172159. [A2A2Y4-4]
    ENST00000376434; ENSP00000365617; ENSG00000172159. [A2A2Y4-3]
    ENST00000376438; ENSP00000365621; ENSG00000172159. [A2A2Y4-2]
    GeneIDi257019.
    KEGGihsa:257019.
    UCSCiuc004amq.1. human. [A2A2Y4-4]
    uc004amr.1. human. [A2A2Y4-2]
    uc004ams.2. human. [A2A2Y4-1]
    uc022biz.1. human. [A2A2Y4-3]
    uc022bja.1. human. [A2A2Y4-5]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY137774 mRNA. Translation: AAN52119.1 .
    AK094281 mRNA. Translation: BAC04321.1 . Different initiation.
    AK297722 mRNA. Translation: BAG60076.1 .
    EF560742 mRNA. Translation: ABQ59052.1 .
    AL161786 , AL137847 Genomic DNA. Translation: CAH72749.1 .
    AL161786 , AL137847 , AL450026 Genomic DNA. Translation: CAH72750.2 .
    AL137847 , AL161786 Genomic DNA. Translation: CAI40734.1 .
    AL137847 , AL161786 , AL450026 Genomic DNA. Translation: CAI40735.2 .
    AL137847 Genomic DNA. Translation: CAI40736.1 .
    AL161786 , AL137847 , AL450026 Genomic DNA. Translation: CAM17460.1 .
    AL450026 , AL137847 , AL161786 Genomic DNA. Translation: CAM19643.1 .
    AL450026 , AL137847 , AL161786 Genomic DNA. Translation: CAM19644.1 .
    AL137847 , AL161786 , AL450026 Genomic DNA. Translation: CAM19673.1 .
    CH471089 Genomic DNA. Translation: EAW62647.1 .
    CH471089 Genomic DNA. Translation: EAW62649.1 .
    CH471089 Genomic DNA. Translation: EAW62650.1 . Different initiation.
    CH471089 Genomic DNA. Translation: EAW62651.1 .
    BC023560 mRNA. Translation: AAH23560.1 .
    BC037253 mRNA. Translation: AAH37253.1 .
    AK223597 mRNA. Translation: BAD97317.1 .
    CCDSi CCDS43840.1. [A2A2Y4-1 ]
    CCDS59131.1. [A2A2Y4-4 ]
    CCDS59132.1. [A2A2Y4-3 ]
    CCDS59133.1. [A2A2Y4-2 ]
    RefSeqi NP_001231888.1. NM_001244959.1. [A2A2Y4-2 ]
    NP_001231889.1. NM_001244960.1. [A2A2Y4-5 ]
    NP_001231890.1. NM_001244961.1. [A2A2Y4-3 ]
    NP_001231891.1. NM_001244962.1. [A2A2Y4-4 ]
    NP_777598.3. NM_174938.5. [A2A2Y4-1 ]
    UniGenei Hs.127535.
    Hs.743606.

    3D structure databases

    ProteinModelPortali A2A2Y4.
    SMRi A2A2Y4. Positions 30-309.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi A2A2Y4. 3 interactions.

    PTM databases

    PhosphoSitei A2A2Y4.

    Proteomic databases

    MaxQBi A2A2Y4.
    PaxDbi A2A2Y4.
    PRIDEi A2A2Y4.

    Protocols and materials databases

    DNASUi 257019.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000304195 ; ENSP00000303508 ; ENSG00000172159 . [A2A2Y4-1 ]
    ENST00000328788 ; ENSP00000328615 ; ENSG00000172159 . [A2A2Y4-4 ]
    ENST00000376434 ; ENSP00000365617 ; ENSG00000172159 . [A2A2Y4-3 ]
    ENST00000376438 ; ENSP00000365621 ; ENSG00000172159 . [A2A2Y4-2 ]
    GeneIDi 257019.
    KEGGi hsa:257019.
    UCSCi uc004amq.1. human. [A2A2Y4-4 ]
    uc004amr.1. human. [A2A2Y4-2 ]
    uc004ams.2. human. [A2A2Y4-1 ]
    uc022biz.1. human. [A2A2Y4-3 ]
    uc022bja.1. human. [A2A2Y4-5 ]

    Organism-specific databases

    CTDi 257019.
    GeneCardsi GC09M085857.
    H-InvDB HIX0023043.
    HGNCi HGNC:24125. FRMD3.
    HPAi HPA017285.
    MIMi 607619. gene.
    neXtProti NX_A2A2Y4.
    PharmGKBi PA134903920.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG331698.
    HOVERGENi HBG057180.
    InParanoidi A2A2Y4.
    OMAi FLCEIRQ.
    OrthoDBi EOG7M98FW.
    PhylomeDBi A2A2Y4.
    TreeFami TF343477.

    Miscellaneous databases

    GenomeRNAii 257019.
    NextBioi 92903.
    PROi A2A2Y4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi A2A2Y4.
    Bgeei A2A2Y4.
    Genevestigatori A2A2Y4.

    Family and domain databases

    Gene3Di 1.20.80.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProi IPR019749. Band_41_domain.
    IPR019750. Band_41_fam.
    IPR000798. Ez/rad/moesin_like.
    IPR014847. FERM-adjacent.
    IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
    IPR019748. FERM_central.
    IPR019747. FERM_CS.
    IPR000299. FERM_domain.
    IPR018979. FERM_N.
    IPR018980. FERM_PH-like_C.
    IPR011993. PH_like_dom.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view ]
    Pfami PF08736. FA. 1 hit.
    PF09380. FERM_C. 1 hit.
    PF00373. FERM_M. 1 hit.
    PF09379. FERM_N. 1 hit.
    [Graphical view ]
    PRINTSi PR00935. BAND41.
    PR00661. ERMFAMILY.
    SMARTi SM00295. B41. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47031. SSF47031. 1 hit.
    SSF54236. SSF54236. 1 hit.
    PROSITEi PS00660. FERM_1. 1 hit.
    PS50057. FERM_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of the protein 4.1O gene, a novel member of the protein 4.1 family with focal expression in ovary."
      Ni X., Ji C., Cao G., Cheng H., Guo L., Gu S., Ying K., Zhao R.C., Mao Y.
      J. Hum. Genet. 48:101-106(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Tissue: Fetal brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 34-597 (ISOFORM 2).
      Tissue: Cerebellum.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Tissue: Brain and Placenta.
    7. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-597 (ISOFORM 1).
      Tissue: Kidney.
    8. Cited for: FUNCTION.

    Entry informationi

    Entry nameiFRMD3_HUMAN
    AccessioniPrimary (citable) accession number: A2A2Y4
    Secondary accession number(s): A8MQB0
    , B4DN14, Q53EP2, Q5JV59, Q5VZA1, Q86WP8, Q8IZ44, Q8N3Y5, Q8N9L2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 5, 2008
    Last sequence update: February 20, 2007
    Last modified: October 1, 2014
    This is version 74 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3