Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein unc-104

Gene

unc-104

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for presynaptic maturation, has a role in axonal transport of dense-core vesicles carrying synaptic vesicle precursors, components required for the morphological transformation of axonal growth cones to mature boutons.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi97 – 1048ATPPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

  • anterograde axonal transport Source: FlyBase
  • anterograde synaptic vesicle transport Source: FlyBase
  • axo-dendritic transport Source: FlyBase
  • axon guidance Source: FlyBase
  • filopodium assembly Source: FlyBase
  • larval locomotory behavior Source: FlyBase
  • negative regulation of synaptic growth at neuromuscular junction Source: FlyBase
  • neuromuscular junction development Source: FlyBase
  • positive regulation of insulin secretion Source: FlyBase
  • regulation of dendrite morphogenesis Source: FlyBase
  • regulation of locomotion Source: FlyBase
  • regulation of synapse assembly Source: FlyBase
  • synaptic vesicle maturation Source: FlyBase
  • synaptic vesicle transport Source: UniProtKB
  • vesicle-mediated transport Source: FlyBase
  • vesicle transport along microtubule Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein unc-104
Alternative name(s):
Protein immaculate connections
Short name:
DUnc104
Gene namesi
Name:unc-104
Synonyms:imac1 Publication
ORF Names:CG8566
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0267002. unc-104.

Subcellular locationi

GO - Cellular componenti

  • axon Source: FlyBase
  • axon cytoplasm Source: GOC
  • dendrite Source: FlyBase
  • kinesin complex Source: GO_Central
  • microtubule Source: UniProtKB-KW
  • microtubule associated complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Disruption phenotypei

Flies prevent nerve endings from transforming to synaptic boutons: growth cones become constricted but remain within contact fields as thin processes that lack varicosities or boutons. Mutant embryos die at late stage, they are paralyzed and lacked the coordinated muscle peristalsis required for hatching.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16701670Kinesin-like protein unc-104PRO_0000299496Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1406 – 14061Phosphothreonine1 Publication
Modified residuei1416 – 14161Phosphoserine1 Publication
Modified residuei1419 – 14191Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiA1ZAJ2.

PTM databases

iPTMnetiA1ZAJ2.

Expressioni

Tissue specificityi

Expressed in muscles.1 Publication

Gene expression databases

BgeeiFBgn0034155.
GenevisibleiA1ZAJ2. DM.

Interactioni

Subunit structurei

Monomer.By similarity

Protein-protein interaction databases

BioGridi62585. 1 interaction.
IntActiA1ZAJ2. 5 interactions.

Structurei

3D structure databases

ProteinModelPortaliA1ZAJ2.
SMRiA1ZAJ2. Positions 2-350, 413-580.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini3 – 351349Kinesin motorPROSITE-ProRule annotationAdd
BLAST
Domaini499 – 56567FHASequence analysisAdd
BLAST
Domaini1537 – 163599PHPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili358 – 43679Sequence analysisAdd
BLAST
Coiled coili576 – 67499Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation
Contains 1 FHA domain.Sequence analysis
Contains 1 kinesin motor domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

GeneTreeiENSGT00840000129680.
InParanoidiA1ZAJ2.
KOiK10392.
OMAiVIRRRLC.
OrthoDBiEOG091G009V.
PhylomeDBiA1ZAJ2.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR022140. Kinesin-like_KIF1-typ.
IPR032405. Kinesin_assoc.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 2 hits.
PfamiPF12473. DUF3694. 1 hit.
PF00498. FHA. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF16183. Kinesin_assoc. 2 hits.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: A1ZAJ2-1) [UniParc]FASTAAdd to basket
Also known as: C

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSVKVAVRV RPFNSREIAR ESKCIIEMAG ATTAITNPKV PPNTSDSVKR
60 70 80 90 100
FNFDYSYWSH DHHDADFSTQ SMVYKDIGEE MLQHSFDGYN VCIFAYGQTG
110 120 130 140 150
AGKSYTMMGR QEEQQEGIIP MICKDLFTRI QDTETDDLKY SVEVSYMEIY
160 170 180 190 200
CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTDYQ DIHDLIDEGN
210 220 230 240 250
KARTVAATNM NETSSRSHAV FTIFFTQRRH DLMTNLTTEK VSKISLVDLA
260 270 280 290 300
GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVAS KKKNTKKADF
310 320 330 340 350
IPYRDSALTW LLRENLGGNS KTAMIAAISP ADINYDETLS TLRYADRAKQ
360 370 380 390 400
IVCKAVVNED ANAKLIRELK EEIQKLRDLL KAEGIEVQEE DELTKSTVIK
410 420 430 440 450
SPTKSRNRNG STTEMAVDQL QASEKLIAEL NETWEEKLKR TEEIRVQREA
460 470 480 490 500
VFAEMGVAVK EDGITVGVFS PKKTPHLVNL NEDPNLSECL LYYIKEGLTR
510 520 530 540 550
LGTHEANVPQ DIQLSGSHIL KEHCTFENKN STVTLLPHKD AIIYVNGRKL
560 570 580 590 600
VEPEVLKTGS RVILGKNHVF RFTNPEQARE LRDKIETENE AENEVEKTDT
610 620 630 640 650
QQVDWNFAQC ELLEKQGIDL KAEMKKRLDN LEEQYKREKL QADQQFEEQR
660 670 680 690 700
KTYEARIDAL QKQVEEQSMT MSMYSSYSPE DFHQEEDVYT NPMYESCWTA
710 720 730 740 750
REAGLAAWAF RKWRYHQFTS LRDDLWGNAI FLKEANAISV ELKKKVQFQF
760 770 780 790 800
TLLTDTLYSP LPPELASTVA PVHQEDEFGA PPVSKTLVAV EVTDTKNGAT
810 820 830 840 850
HHWSLEKLRQ RLELMREMYH NEAEMSPTSP DYNVESLTGG DPFYDRFPWF
860 870 880 890 900
RMVGRSFIYL SNLLYPVPLV HKVAIVNERG DVRGYLRIAV QPVLDEESID
910 920 930 940 950
FNNGVKQSAR LVFNEDDAKP KYRALNEKDD VQRYIDNGGL DSKLEELEDV
960 970 980 990 1000
DSGRGIDSNS ASECHENSEE PGEHLQVGKE FTFRVTVLQA TGIGAEYADI
1010 1020 1030 1040 1050
FCQFNFLHRH EEAFSTEPVK NSASGAPLGF YHVQNITVPV TKSFIEYLKT
1060 1070 1080 1090 1100
QPIMFKIFGH YQTHPLHKDA KQDFVSRPPP RRMLPPSIPI SQPVRSPKFG
1110 1120 1130 1140 1150
PLPCAPTSTV LAKHDVLVWF EICELAPNGE YVPSVVEHSD DLPCRGLFLL
1160 1170 1180 1190 1200
HQGIQRRIRI TIVHEPTTEV KWKDINELVV GRIRNTPESS DEQDEDACVL
1210 1220 1230 1240 1250
SLGLFPGEAL EVPGDDRSFY RFEAAWDSSL HNSALLNRVS QGGETIYITL
1260 1270 1280 1290 1300
SAYLELENCA RPAIITKDLS MVIYGRDART GPRSLKHLFS GQYRNPEANR
1310 1320 1330 1340 1350
LTGVYELALR RASEAGSPGV QRRQRRVLDT SSTYVRGEEN LHGWRPRGDS
1360 1370 1380 1390 1400
LIFDHQWELE KLTRLEEVGR MRHLLLLRER LGMDTNPNPT TKTEKDVCNL
1410 1420 1430 1440 1450
AARAATSPVH MVIPQSPQTP VKDPQQIIPE REYNQREQDL MLKCLKLVQG
1460 1470 1480 1490 1500
RYTKSEANDT QTQSDVSPSD EGCADMTVSC ISSNSMENNK FVIRRRLCSP
1510 1520 1530 1540 1550
DRADAPNGWE APAPATQPAL PLRLYVPELE EIRVSPVVAR KGLLNVLEHG
1560 1570 1580 1590 1600
GSGWKKRWVI VRRPYVFIYR SEKDPVERAV LNLATAHVEC SEDQAAMVKI
1610 1620 1630 1640 1650
PNTFSVVTKH RGYLLQTLGD KEVHDWLYAI NPLLAGQIKS RLARRTLEPA
1660 1670
SQTASQIQAT NAANANSASK
Length:1,670
Mass (Da):189,345
Last modified:February 6, 2007 - v1
Checksum:i263A8EF721B214E0
GO
Isoform D (identifier: A1ZAJ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     809-809: R → RYRLELMRQIYNVESPPSSMLFDTSGMEALSGWISPPSQHPGQQAQLLPLEPPVESERGRLTLANLIPSR

Note: No experimental confirmation available.
Show »
Length:1,739
Mass (Da):197,046
Checksum:i9D6D4A0B034F00FA
GO
Isoform E (identifier: A1ZAJ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-390: E → GPDGKVVCEKRDANK

Note: No experimental confirmation available.
Show »
Length:1,684
Mass (Da):190,814
Checksum:i1080A07AB127B160
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti288 – 2881V → VS in AAF74192 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei390 – 3901E → GPDGKVVCEKRDANK in isoform E. CuratedVSP_030268
Alternative sequencei809 – 8091R → RYRLELMRQIYNVESPPSSM LFDTSGMEALSGWISPPSQH PGQQAQLLPLEPPVESERGR LTLANLIPSR in isoform D. CuratedVSP_030269

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF247761 mRNA. Translation: AAF74192.1.
AE013599 Genomic DNA. Translation: AAF57957.3.
AE013599 Genomic DNA. Translation: AAM70884.2.
AE013599 Genomic DNA. Translation: AAM70886.2.
AE013599 Genomic DNA. Translation: ABV53825.1.
RefSeqiNP_001097346.1. NM_001103876.3. [A1ZAJ2-3]
NP_611155.3. NM_137311.5. [A1ZAJ2-2]
NP_725607.2. NM_166190.4. [A1ZAJ2-1]
NP_725610.2. NM_166192.4. [A1ZAJ2-1]

Genome annotation databases

EnsemblMetazoaiFBtr0113087; FBpp0112000; FBgn0267002. [A1ZAJ2-1]
FBtr0113088; FBpp0112001; FBgn0267002. [A1ZAJ2-1]
GeneIDi36876.
KEGGidme:Dmel_CG8566.
UCSCiCG8566-RB. d. melanogaster. [A1ZAJ2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF247761 mRNA. Translation: AAF74192.1.
AE013599 Genomic DNA. Translation: AAF57957.3.
AE013599 Genomic DNA. Translation: AAM70884.2.
AE013599 Genomic DNA. Translation: AAM70886.2.
AE013599 Genomic DNA. Translation: ABV53825.1.
RefSeqiNP_001097346.1. NM_001103876.3. [A1ZAJ2-3]
NP_611155.3. NM_137311.5. [A1ZAJ2-2]
NP_725607.2. NM_166190.4. [A1ZAJ2-1]
NP_725610.2. NM_166192.4. [A1ZAJ2-1]

3D structure databases

ProteinModelPortaliA1ZAJ2.
SMRiA1ZAJ2. Positions 2-350, 413-580.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi62585. 1 interaction.
IntActiA1ZAJ2. 5 interactions.

PTM databases

iPTMnetiA1ZAJ2.

Proteomic databases

PRIDEiA1ZAJ2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0113087; FBpp0112000; FBgn0267002. [A1ZAJ2-1]
FBtr0113088; FBpp0112001; FBgn0267002. [A1ZAJ2-1]
GeneIDi36876.
KEGGidme:Dmel_CG8566.
UCSCiCG8566-RB. d. melanogaster. [A1ZAJ2-1]

Organism-specific databases

CTDi36876.
FlyBaseiFBgn0267002. unc-104.

Phylogenomic databases

GeneTreeiENSGT00840000129680.
InParanoidiA1ZAJ2.
KOiK10392.
OMAiVIRRRLC.
OrthoDBiEOG091G009V.
PhylomeDBiA1ZAJ2.

Miscellaneous databases

GenomeRNAii36876.
PROiA1ZAJ2.

Gene expression databases

BgeeiFBgn0034155.
GenevisibleiA1ZAJ2. DM.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR022140. Kinesin-like_KIF1-typ.
IPR032405. Kinesin_assoc.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 2 hits.
PfamiPF12473. DUF3694. 1 hit.
PF00498. FHA. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF16183. Kinesin_assoc. 2 hits.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKIF1A_DROME
AccessioniPrimary (citable) accession number: A1ZAJ2
Secondary accession number(s): A8DX00, A8DYG5, Q9NBL1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: February 6, 2007
Last modified: September 7, 2016
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.