SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A1L243

- MESD_DANRE

UniProt

A1L243 - MESD_DANRE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

LDLR chaperone MESD

Gene
mesdc2, zgc:158636
Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway, since some LDLRs are coreceptors for the canonical Wnt pathway By similarity.

GO - Biological processi

  1. Wnt signaling pathway Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Keywords - Biological processi

Wnt signaling pathway

Names & Taxonomyi

Protein namesi
Recommended name:
LDLR chaperone MESD
Alternative name(s):
Mesoderm development candidate 2
Mesoderm development protein
Gene namesi
Name:mesdc2
ORF Names:zgc:158636
OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
Taxonomic identifieri7955 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
ProteomesiUP000000437: Chromosome 7

Organism-specific databases

ZFINiZDB-GENE-070112-2142. mesdc2.

Subcellular locationi

Endoplasmic reticulum By similarity

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424 Reviewed predictionAdd
BLAST
Chaini25 – 206182LDLR chaperone MESDPRO_0000385020Add
BLAST

Proteomic databases

PRIDEiA1L243.

Interactioni

Subunit structurei

Monomer By similarity.

Protein-protein interaction databases

STRINGi7955.ENSDARP00000093291.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni93 – 16674Structured core By similarityAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi203 – 2064Prevents secretion from ER

Domaini

The LDLR maturation activity resides in the N- and C-terminal unstructured regions By similarity.

Sequence similaritiesi

Belongs to the MESD family.

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG286690.
GeneTreeiENSGT00390000000993.
HOGENOMiHOG000230558.
OMAiAIFLFKD.
OrthoDBiEOG7XPZ76.
PhylomeDBiA1L243.
TreeFamiTF315614.

Family and domain databases

InterProiIPR019330. Mesoderm_development_cand-2.
[Graphical view]
PfamiPF10185. Mesd. 1 hit.
[Graphical view]
PROSITEiPS00014. ER_TARGET. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A1L243-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MASSVGCRTL SVLFLLVLFI TVHCTDTKPK KKKDIRDYND ADMARLLEEW    50
EKDDDIEEGD LPEHKRSPPP IDFSKIDASK PEELLKMSKK GKTLMVFASV 100
SGNPTEKETE EITGLWQGSL FNANYDVQRF VVGSNRVIFM LRDGSYAWEI 150
KDFLVSQDRC EDVTVEGQVF PGKNAKKDAK GKEQNETKKK GDKKAANRAN 200
KGKQEL 206
Length:206
Mass (Da):23,307
Last modified:September 22, 2009 - v2
Checksum:i7F3E8C76841FA15A
GO
Isoform 2 (identifier: A1L243-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MASSVGCRTLSVLFLLVLFITVHCTDTKPKKKKDIRDYNDADMARLLEEWE → MFEC

Note: No experimental confirmation available.

Show »
Length:159
Mass (Da):17,933
Checksum:iEA3709CF23829EF6
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151MASSV…LEEWE → MFEC in isoform 2. VSP_038093Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
EH610226 mRNA. No translation available.
BC129340 mRNA. Translation: AAI29341.1.
RefSeqiNP_001074173.1. NM_001080704.1. [A1L243-2]
XP_005166421.1. XM_005166364.1. [A1L243-1]
UniGeneiDr.79372.

Genome annotation databases

EnsembliENSDART00000102515; ENSDARP00000093291; ENSDARG00000063030. [A1L243-1]
GeneIDi791222.
KEGGidre:791222.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
EH610226 mRNA. No translation available.
BC129340 mRNA. Translation: AAI29341.1 .
RefSeqi NP_001074173.1. NM_001080704.1. [A1L243-2 ]
XP_005166421.1. XM_005166364.1. [A1L243-1 ]
UniGenei Dr.79372.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 7955.ENSDARP00000093291.

Proteomic databases

PRIDEi A1L243.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSDART00000102515 ; ENSDARP00000093291 ; ENSDARG00000063030 . [A1L243-1 ]
GeneIDi 791222.
KEGGi dre:791222.

Organism-specific databases

CTDi 23184.
ZFINi ZDB-GENE-070112-2142. mesdc2.

Phylogenomic databases

eggNOGi NOG286690.
GeneTreei ENSGT00390000000993.
HOGENOMi HOG000230558.
OMAi AIFLFKD.
OrthoDBi EOG7XPZ76.
PhylomeDBi A1L243.
TreeFami TF315614.

Miscellaneous databases

NextBioi 20930618.
PROi A1L243.

Family and domain databases

InterProi IPR019330. Mesoderm_development_cand-2.
[Graphical view ]
Pfami PF10185. Mesd. 1 hit.
[Graphical view ]
PROSITEi PS00014. ER_TARGET. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Zebrafish transcriptome characterization."
    Mathavan S., Yao F., Wong E., Thoreau H., Nayudu M., Govindarajan K.R., Ruan Y., Wei C.
    Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: Tuebingen.
    Tissue: Embryo.
  2. NIH - Zebrafish Gene Collection (ZGC) project
    Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.

Entry informationi

Entry nameiMESD_DANRE
AccessioniPrimary (citable) accession number: A1L243
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 22, 2009
Last sequence update: September 22, 2009
Last modified: May 14, 2014
This is version 45 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi