A1L243 (MESD_DANRE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 38.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LDLR chaperone MESD Alternative name(s): Mesoderm development candidate 2 Mesoderm development protein | ||||
| Gene names |
| ||||
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) [Reference proteome] | ||||
| Taxonomic identifier | 7955 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Actinopterygii › Neopterygii › Teleostei › Ostariophysi › Cypriniformes › Cyprinidae › Danio![]() |
Protein attributes
| Sequence length | 206 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway, since some LDLRs are coreceptors for the canonical Wnt pathway By similarity. |
| Subunit structure | Monomer By similarity. |
| Subcellular location | Endoplasmic reticulum By similarity. |
| Domain | The LDLR maturation activity resides in the N- and C-terminal unstructured regions By similarity. |
| Sequence similarities | Belongs to the MESD family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Wnt signaling pathway |
| Cellular component | Endoplasmic reticulum |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | Chaperone |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | Wnt receptor signaling pathway Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | endoplasmic reticulum Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A1L243-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A1L243-2) The sequence of this isoform differs from the canonical sequence as follows: 1-51: MASSVGCRTLSVLFLLVLFITVHCTDTKPKKKKDIRDYNDADMARLLEEWE → MFEC | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Potential | ||||||
| Chain | 25 – 206 | 182 | LDLR chaperone MESD | PRO_0000385020 | |||||
Regions | |||||||||
| Region | 93 – 166 | 74 | Structured core By similarity | ||||||
| Motif | 203 – 206 | 4 | Prevents secretion from ER | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 51 | 51 | MASSV…LEEWE → MFEC in isoform 2. | VSP_038093 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Zebrafish transcriptome characterization." Mathavan S., Yao F., Wong E., Thoreau H., Nayudu M., Govindarajan K.R., Ruan Y., Wei C. Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: Tuebingen. Tissue: Embryo. |
| [2] | NIH - Zebrafish Gene Collection (ZGC) project Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | EH610226 mRNA. No translation available. BC129340 mRNA. Translation: AAI29341.1. |
| IPI | IPI00804403. IPI00944859. |
| RefSeq | NP_001074173.1. NM_001080704.1. |
| UniGene | Dr.79372. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 7955.ENSDARP00000093291. |
Proteomic databases | |
| PRIDE | A1L243. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSDART00000102515; ENSDARP00000093291; ENSDARG00000063030. |
| GeneID | 791222. |
| KEGG | dre:791222. |
Organism-specific databases | |
| CTD | 23184. |
| ZFIN | ZDB-GENE-070112-2142. mesdc2. |
Phylogenomic databases | |
| eggNOG | NOG286690. |
| GeneTree | ENSGT00390000000993. |
| HOGENOM | HOG000230558. |
| OrthoDB | EOG4QRH59. |
Family and domain databases | |
| InterPro | IPR019330. Mesoderm_development_cand-2. [Graphical view] |
| Pfam | PF10185. Mesd. 1 hit. [Graphical view] |
| PROSITE | PS00014. ER_TARGET. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20930618. |
Entry information
| Entry name | MESD_DANRE | ||||||||
| Accession | Primary (citable) accession number: A1L243 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
