Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LDLR chaperone MESD

Gene

mesdc2

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway, since some LDLRs are coreceptors for the canonical Wnt pathway (By similarity).By similarity

GO - Biological processi

  1. Wnt signaling pathway Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Keywords - Biological processi

Wnt signaling pathway

Names & Taxonomyi

Protein namesi
Recommended name:
LDLR chaperone MESD
Alternative name(s):
Mesoderm development candidate 2
Mesoderm development protein
Gene namesi
Name:mesdc2
ORF Names:zgc:158636
OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
Taxonomic identifieri7955 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
ProteomesiUP000000437: Chromosome 7

Organism-specific databases

ZFINiZDB-GENE-070112-2142. mesdc2.

Subcellular locationi

Endoplasmic reticulum PROSITE-ProRule annotation

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424Sequence AnalysisAdd
BLAST
Chaini25 – 206182LDLR chaperone MESDPRO_0000385020Add
BLAST

Proteomic databases

PRIDEiA1L243.

Interactioni

Subunit structurei

Monomer.By similarity

Protein-protein interaction databases

STRINGi7955.ENSDARP00000093291.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni93 – 16674Structured coreBy similarityAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi203 – 2064Prevents secretion from ER

Domaini

The LDLR maturation activity resides in the N- and C-terminal unstructured regions.By similarity

Sequence similaritiesi

Belongs to the MESD family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG286690.
GeneTreeiENSGT00390000000993.
HOGENOMiHOG000230558.
InParanoidiA1L243.
OMAiVEGQVYP.
OrthoDBiEOG7XPZ76.
PhylomeDBiA1L243.
TreeFamiTF315614.

Family and domain databases

InterProiIPR019330. Mesoderm_development_cand-2.
[Graphical view]
PfamiPF10185. Mesd. 1 hit.
[Graphical view]
PROSITEiPS00014. ER_TARGET. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A1L243-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASSVGCRTL SVLFLLVLFI TVHCTDTKPK KKKDIRDYND ADMARLLEEW
60 70 80 90 100
EKDDDIEEGD LPEHKRSPPP IDFSKIDASK PEELLKMSKK GKTLMVFASV
110 120 130 140 150
SGNPTEKETE EITGLWQGSL FNANYDVQRF VVGSNRVIFM LRDGSYAWEI
160 170 180 190 200
KDFLVSQDRC EDVTVEGQVF PGKNAKKDAK GKEQNETKKK GDKKAANRAN

KGKQEL
Length:206
Mass (Da):23,307
Last modified:September 22, 2009 - v2
Checksum:i7F3E8C76841FA15A
GO
Isoform 2 (identifier: A1L243-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MASSVGCRTLSVLFLLVLFITVHCTDTKPKKKKDIRDYNDADMARLLEEWE → MFEC

Note: No experimental confirmation available.

Show »
Length:159
Mass (Da):17,933
Checksum:iEA3709CF23829EF6
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151MASSV…LEEWE → MFEC in isoform 2. 1 PublicationVSP_038093Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EH610226 mRNA. No translation available.
BC129340 mRNA. Translation: AAI29341.1.
RefSeqiNP_001074173.1. NM_001080704.1. [A1L243-2]
XP_005166421.1. XM_005166364.2. [A1L243-1]
UniGeneiDr.79372.

Genome annotation databases

EnsembliENSDART00000102515; ENSDARP00000093291; ENSDARG00000063030. [A1L243-1]
GeneIDi791222.
KEGGidre:791222.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EH610226 mRNA. No translation available.
BC129340 mRNA. Translation: AAI29341.1.
RefSeqiNP_001074173.1. NM_001080704.1. [A1L243-2]
XP_005166421.1. XM_005166364.2. [A1L243-1]
UniGeneiDr.79372.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi7955.ENSDARP00000093291.

Proteomic databases

PRIDEiA1L243.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSDART00000102515; ENSDARP00000093291; ENSDARG00000063030. [A1L243-1]
GeneIDi791222.
KEGGidre:791222.

Organism-specific databases

CTDi23184.
ZFINiZDB-GENE-070112-2142. mesdc2.

Phylogenomic databases

eggNOGiNOG286690.
GeneTreeiENSGT00390000000993.
HOGENOMiHOG000230558.
InParanoidiA1L243.
OMAiVEGQVYP.
OrthoDBiEOG7XPZ76.
PhylomeDBiA1L243.
TreeFamiTF315614.

Miscellaneous databases

NextBioi20930618.
PROiA1L243.

Family and domain databases

InterProiIPR019330. Mesoderm_development_cand-2.
[Graphical view]
PfamiPF10185. Mesd. 1 hit.
[Graphical view]
PROSITEiPS00014. ER_TARGET. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Zebrafish transcriptome characterization."
    Mathavan S., Yao F., Wong E., Thoreau H., Nayudu M., Govindarajan K.R., Ruan Y., Wei C.
    Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: Tuebingen.
    Tissue: Embryo.
  2. NIH - Zebrafish Gene Collection (ZGC) project
    Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.

Entry informationi

Entry nameiMESD_DANRE
AccessioniPrimary (citable) accession number: A1L243
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 22, 2009
Last sequence update: September 22, 2009
Last modified: January 7, 2015
This is version 49 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.