Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A1L243 (MESD_DANRE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 44. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
LDLR chaperone MESD
Alternative name(s):
Mesoderm development candidate 2
Mesoderm development protein
Gene names
Name:mesdc2
ORF Names:zgc:158636
OrganismDanio rerio (Zebrafish) (Brachydanio rerio) [Reference proteome]
Taxonomic identifier7955 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio

Protein attributes

Sequence length206 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway, since some LDLRs are coreceptors for the canonical Wnt pathway By similarity.

Subunit structure

Monomer By similarity.

Subcellular location

Endoplasmic reticulum By similarity.

Domain

The LDLR maturation activity resides in the N- and C-terminal unstructured regions By similarity.

Sequence similarities

Belongs to the MESD family.

Ontologies

Keywords
   Biological processWnt signaling pathway
   Cellular componentEndoplasmic reticulum
   Coding sequence diversityAlternative splicing
   DomainSignal
   Molecular functionChaperone
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processWnt signaling pathway

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentendoplasmic reticulum

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A1L243-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A1L243-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MASSVGCRTLSVLFLLVLFITVHCTDTKPKKKKDIRDYNDADMARLLEEWE → MFEC
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424 Potential
Chain25 – 206182LDLR chaperone MESD
PRO_0000385020

Regions

Region93 – 16674Structured core By similarity
Motif203 – 2064Prevents secretion from ER

Natural variations

Alternative sequence1 – 5151MASSV…LEEWE → MFEC in isoform 2.
VSP_038093

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 22, 2009. Version 2.
Checksum: 7F3E8C76841FA15A

FASTA20623,307
        10         20         30         40         50         60 
MASSVGCRTL SVLFLLVLFI TVHCTDTKPK KKKDIRDYND ADMARLLEEW EKDDDIEEGD 

        70         80         90        100        110        120 
LPEHKRSPPP IDFSKIDASK PEELLKMSKK GKTLMVFASV SGNPTEKETE EITGLWQGSL 

       130        140        150        160        170        180 
FNANYDVQRF VVGSNRVIFM LRDGSYAWEI KDFLVSQDRC EDVTVEGQVF PGKNAKKDAK 

       190        200 
GKEQNETKKK GDKKAANRAN KGKQEL 

« Hide

Isoform 2 [UniParc].

Checksum: EA3709CF23829EF6
Show »

FASTA15917,933

References

[1]"Zebrafish transcriptome characterization."
Mathavan S., Yao F., Wong E., Thoreau H., Nayudu M., Govindarajan K.R., Ruan Y., Wei C.
Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: Tuebingen.
Tissue: Embryo.
[2]NIH - Zebrafish Gene Collection (ZGC) project
Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
EH610226 mRNA. No translation available.
BC129340 mRNA. Translation: AAI29341.1.
RefSeqNP_001074173.1. NM_001080704.1.
XP_005166421.1. XM_005166364.1.
UniGeneDr.79372.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING7955.ENSDARP00000093291.

Proteomic databases

PRIDEA1L243.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSDART00000102515; ENSDARP00000093291; ENSDARG00000063030. [A1L243-1]
GeneID791222.
KEGGdre:791222.

Organism-specific databases

CTD23184.
ZFINZDB-GENE-070112-2142. mesdc2.

Phylogenomic databases

eggNOGNOG286690.
GeneTreeENSGT00390000000993.
HOGENOMHOG000230558.
OMAIVGSNRA.
OrthoDBEOG7XPZ76.
PhylomeDBA1L243.
TreeFamTF315614.

Family and domain databases

InterProIPR019330. Mesoderm_development_cand-2.
[Graphical view]
PfamPF10185. Mesd. 1 hit.
[Graphical view]
PROSITEPS00014. ER_TARGET. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio20930618.
PROA1L243.

Entry information

Entry nameMESD_DANRE
AccessionPrimary (citable) accession number: A1L243
Entry history
Integrated into UniProtKB/Swiss-Prot: September 22, 2009
Last sequence update: September 22, 2009
Last modified: April 16, 2014
This is version 44 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families