Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A1L243

- MESD_DANRE

UniProt

A1L243 - MESD_DANRE

Protein

LDLR chaperone MESD

Gene

mesdc2

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 46 (01 Oct 2014)
      Sequence version 2 (22 Sep 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway, since some LDLRs are coreceptors for the canonical Wnt pathway By similarity.By similarity

    GO - Biological processi

    1. Wnt signaling pathway Source: UniProtKB-KW

    Keywords - Molecular functioni

    Chaperone

    Keywords - Biological processi

    Wnt signaling pathway

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    LDLR chaperone MESD
    Alternative name(s):
    Mesoderm development candidate 2
    Mesoderm development protein
    Gene namesi
    Name:mesdc2
    ORF Names:zgc:158636
    OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
    Taxonomic identifieri7955 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
    ProteomesiUP000000437: Chromosome 7

    Organism-specific databases

    ZFINiZDB-GENE-070112-2142. mesdc2.

    Subcellular locationi

    Endoplasmic reticulum PROSITE-ProRule annotation

    GO - Cellular componenti

    1. endoplasmic reticulum Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Endoplasmic reticulum

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Sequence AnalysisAdd
    BLAST
    Chaini25 – 206182LDLR chaperone MESDPRO_0000385020Add
    BLAST

    Proteomic databases

    PRIDEiA1L243.

    Interactioni

    Subunit structurei

    Monomer.By similarity

    Protein-protein interaction databases

    STRINGi7955.ENSDARP00000093291.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni93 – 16674Structured coreBy similarityAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi203 – 2064Prevents secretion from ER

    Domaini

    The LDLR maturation activity resides in the N- and C-terminal unstructured regions.By similarity

    Sequence similaritiesi

    Belongs to the MESD family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG286690.
    GeneTreeiENSGT00390000000993.
    HOGENOMiHOG000230558.
    OMAiAIFLFKD.
    OrthoDBiEOG7XPZ76.
    PhylomeDBiA1L243.
    TreeFamiTF315614.

    Family and domain databases

    InterProiIPR019330. Mesoderm_development_cand-2.
    [Graphical view]
    PfamiPF10185. Mesd. 1 hit.
    [Graphical view]
    PROSITEiPS00014. ER_TARGET. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A1L243-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASSVGCRTL SVLFLLVLFI TVHCTDTKPK KKKDIRDYND ADMARLLEEW    50
    EKDDDIEEGD LPEHKRSPPP IDFSKIDASK PEELLKMSKK GKTLMVFASV 100
    SGNPTEKETE EITGLWQGSL FNANYDVQRF VVGSNRVIFM LRDGSYAWEI 150
    KDFLVSQDRC EDVTVEGQVF PGKNAKKDAK GKEQNETKKK GDKKAANRAN 200
    KGKQEL 206
    Length:206
    Mass (Da):23,307
    Last modified:September 22, 2009 - v2
    Checksum:i7F3E8C76841FA15A
    GO
    Isoform 2 (identifier: A1L243-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-51: MASSVGCRTLSVLFLLVLFITVHCTDTKPKKKKDIRDYNDADMARLLEEWE → MFEC

    Note: No experimental confirmation available.

    Show »
    Length:159
    Mass (Da):17,933
    Checksum:iEA3709CF23829EF6
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5151MASSV…LEEWE → MFEC in isoform 2. 1 PublicationVSP_038093Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    EH610226 mRNA. No translation available.
    BC129340 mRNA. Translation: AAI29341.1.
    RefSeqiNP_001074173.1. NM_001080704.1. [A1L243-2]
    XP_005166421.1. XM_005166364.1. [A1L243-1]
    UniGeneiDr.79372.

    Genome annotation databases

    EnsembliENSDART00000102515; ENSDARP00000093291; ENSDARG00000063030. [A1L243-1]
    GeneIDi791222.
    KEGGidre:791222.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    EH610226 mRNA. No translation available.
    BC129340 mRNA. Translation: AAI29341.1 .
    RefSeqi NP_001074173.1. NM_001080704.1. [A1L243-2 ]
    XP_005166421.1. XM_005166364.1. [A1L243-1 ]
    UniGenei Dr.79372.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 7955.ENSDARP00000093291.

    Proteomic databases

    PRIDEi A1L243.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSDART00000102515 ; ENSDARP00000093291 ; ENSDARG00000063030 . [A1L243-1 ]
    GeneIDi 791222.
    KEGGi dre:791222.

    Organism-specific databases

    CTDi 23184.
    ZFINi ZDB-GENE-070112-2142. mesdc2.

    Phylogenomic databases

    eggNOGi NOG286690.
    GeneTreei ENSGT00390000000993.
    HOGENOMi HOG000230558.
    OMAi AIFLFKD.
    OrthoDBi EOG7XPZ76.
    PhylomeDBi A1L243.
    TreeFami TF315614.

    Miscellaneous databases

    NextBioi 20930618.
    PROi A1L243.

    Family and domain databases

    InterProi IPR019330. Mesoderm_development_cand-2.
    [Graphical view ]
    Pfami PF10185. Mesd. 1 hit.
    [Graphical view ]
    PROSITEi PS00014. ER_TARGET. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Zebrafish transcriptome characterization."
      Mathavan S., Yao F., Wong E., Thoreau H., Nayudu M., Govindarajan K.R., Ruan Y., Wei C.
      Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: Tuebingen.
      Tissue: Embryo.
    2. NIH - Zebrafish Gene Collection (ZGC) project
      Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.

    Entry informationi

    Entry nameiMESD_DANRE
    AccessioniPrimary (citable) accession number: A1L243
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 22, 2009
    Last sequence update: September 22, 2009
    Last modified: October 1, 2014
    This is version 46 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3