Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C1orf226

Gene

C1orf226

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C1orf226
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000239887.4.
HGNCiHGNC:34351. C1orf226.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000239887.
PharmGKBiPA164717033.

Polymorphism and mutation databases

BioMutaiC1orf226.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003346791 – 272Uncharacterized protein C1orf226Add BLAST272

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei222PhosphoserineCombined sources1
Modified residuei223PhosphoserineCombined sources1
Modified residuei249PhosphoserineCombined sources1
Modified residuei258PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiA1L170.
MaxQBiA1L170.
PaxDbiA1L170.
PRIDEiA1L170.

PTM databases

iPTMnetiA1L170.
PhosphoSitePlusiA1L170.

Expressioni

Gene expression databases

BgeeiENSG00000239887.
CleanExiHS_C1orf226.
ExpressionAtlasiA1L170. baseline and differential.
GenevisibleiA1L170. HS.

Organism-specific databases

HPAiHPA052251.

Interactioni

Protein-protein interaction databases

BioGridi134762. 14 interactors.
IntActiA1L170. 5 interactors.
STRINGi9606.ENSP00000413150.

Structurei

3D structure databases

ProteinModelPortaliA1L170.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IK4X. Eukaryota.
ENOG410ZKK2. LUCA.
GeneTreeiENSGT00510000049665.
HOGENOMiHOG000069901.
HOVERGENiHBG107570.
InParanoidiA1L170.
OMAiGHYVKCV.
OrthoDBiEOG091G0KY5.
PhylomeDBiA1L170.
TreeFamiTF343380.

Family and domain databases

InterProiView protein in InterPro
IPR027851. DUF4628.
PfamiView protein in Pfam
PF15429. DUF4628. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A1L170-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFENLNTALT PKLQASRSFP HLSKPVAPGS APLGSGEPGG PGLWVGSSQH
60 70 80 90 100
LKNLGKAMGA KVNDFLRRKE PSSLGSVGVT EINKTAGAQL ASGTDAAPEA
110 120 130 140 150
WLEDERSVLQ ETFPRLDPPP PITRKRTPRA LKTTQDMLIS SQPVLSSLEY
160 170 180 190 200
GTEPSPGQAQ DSAPTAQPDV PADASQPEAT MEREERGKVL PNGEVSLSVP
210 220 230 240 250
DLIHKDSQDE SKLKMTECRR ASSPSLIERN GFKLSLSPIS LAESWEDGSP
260 270
PPQARTSSLD NEGPHPDLLS FE
Length:272
Mass (Da):29,057
Last modified:February 6, 2007 - v1
Checksum:i01D9EA3C6AD46ED1
GO
Isoform 2 (identifier: A1L170-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLVLVAQAGGDTLKVTGHYVKCVFLLFVSHLLSEPLSRTVDHGM

Show »
Length:315
Mass (Da):33,692
Checksum:iA8427EBBC4D507F7
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0407911M → MLVLVAQAGGDTLKVTGHYV KCVFLLFVSHLLSEPLSRTV DHGM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293907 mRNA. Translation: BAG57292.1.
AL512785 Genomic DNA. No translation available.
BC127743 mRNA. Translation: AAI27744.1.
BC127744 mRNA. Translation: AAI27745.1.
CCDSiCCDS44268.1. [A1L170-2]
CCDS53422.1. [A1L170-1]
RefSeqiNP_001078844.1. NM_001085375.1. [A1L170-1]
NP_001128712.1. NM_001135240.1. [A1L170-2]
UniGeneiHs.447011.

Genome annotation databases

EnsembliENST00000426197; ENSP00000413150; ENSG00000239887. [A1L170-2]
ENST00000458626; ENSP00000437071; ENSG00000239887. [A1L170-1]
GeneIDi400793.
KEGGihsa:400793.
UCSCiuc001gby.2. human. [A1L170-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCA226_HUMAN
AccessioniPrimary (citable) accession number: A1L170
Secondary accession number(s): B4DF31
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: February 6, 2007
Last modified: September 27, 2017
This is version 86 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM