Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A1A5B4

- ANO9_HUMAN

UniProt

A1A5B4 - ANO9_HUMAN

Protein

Anoctamin-9

Gene

ANO9

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 72 (01 Oct 2014)
      Sequence version 2 (03 Mar 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Does not exhibit calcium-activated chloride channel (CaCC) activity. Can inhibit the activity of ANO1.2 Publications

    GO - Molecular functioni

    1. intracellular calcium activated chloride channel activity Source: UniProt

    GO - Biological processi

    1. chloride transmembrane transport Source: GOC
    2. chloride transport Source: UniProt
    3. ion transmembrane transport Source: Reactome
    4. negative regulation of intracellular calcium activated chloride channel activity Source: UniProt
    5. transmembrane transport Source: Reactome

    Enzyme and pathway databases

    ReactomeiREACT_160189. Stimuli-sensing channels.

    Protein family/group databases

    TCDBi1.A.17.1.5. the calcium-dependent chloride channel (ca-clc) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Anoctamin-9
    Alternative name(s):
    Transmembrane protein 16J
    Tumor protein p53-inducible protein 5
    p53-induced gene 5 protein
    Gene namesi
    Name:ANO9
    Synonyms:PIG5, TMEM16J, TP53I5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:20679. ANO9.

    Subcellular locationi

    Cell membrane 2 Publications; Multi-pass membrane protein 2 Publications
    Note: Shows predominantly an intracellular localization with a weak expression in the cell membrane.

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. intracellular Source: Ensembl
    3. plasma membrane Source: UniProt

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164715791.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 782782Anoctamin-9PRO_0000289329Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi641 – 6411N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi652 – 6521N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi674 – 6741N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi690 – 6901N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiA1A5B4.
    PRIDEiA1A5B4.

    Expressioni

    Gene expression databases

    BgeeiA1A5B4.
    CleanExiHS_ANO9.
    GenevestigatoriA1A5B4.

    Organism-specific databases

    HPAiHPA039948.

    Interactioni

    Protein-protein interaction databases

    IntActiA1A5B4. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliA1A5B4.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 198198CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini220 – 26445ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini286 – 33146CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini353 – 37321ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini395 – 42329CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini445 – 552108ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini574 – 60431CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini626 – 70378ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini725 – 78258CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei199 – 21921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei265 – 28521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei332 – 35221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei374 – 39421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei424 – 44421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei553 – 57321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei605 – 62521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei704 – 72421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the anoctamin family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG327201.
    HOGENOMiHOG000006509.
    HOVERGENiHBG100444.
    InParanoidiA1A5B4.
    OMAiKYHYGPC.
    OrthoDBiEOG776SPC.
    PhylomeDBiA1A5B4.
    TreeFamiTF314265.

    Family and domain databases

    InterProiIPR007632. Anoctamin.
    [Graphical view]
    PANTHERiPTHR12308. PTHR12308. 1 hit.
    PfamiPF04547. Anoctamin. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A1A5B4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQGEESLRIL VEPEGDSFPL MEISTCETEA SEQWDYVLVA QRHTQRDPRQ    50
    ARQQQFLEEL RRKGFHIKVI RDQKQVFFGI RADNSVFGLY RTFLLEPEGP 100
    APHAELAAPT TIPVTTSLRI RIVNFVVMNN KTSAGETFED LMKDGVFEAR 150
    FPLHKGEGRL KKTWARWRHM FREQPVDEIR NYFGEKVALY FVWLGWYTYM 200
    LVPAALTGLL VFLSGFSLFE ASQISKEICE AHDILMCPLG DHSRRYQRLS 250
    ETCTFAKLTH LFDNDGTVVF AIFMALWATV FLEIWKRQRA RVVLHWDLYV 300
    WDEEQEEMAL QLINCPDYKL RPYQHSYLRS TVILVLTLLM ICLMIGMAHV 350
    LVVYRVLASA LFSSSAVPFL EEQVTTAVVV TGALVHYVTI IIMTKINRCV 400
    ALKLCDFEMP RTFSERESRF TIRFFTLQFF THFSSLIYIA FILGRINGHP 450
    GKSTRLAGLW KLEECHASGC MMDLFVQMAI IMGLKQTLSN CVEYLVPWVT 500
    HKCRSLRASE SGHLPRDPEL RDWRRNYLLN PVNTFSLFDE FMEMMIQYGF 550
    TTIFVAAFPL APLLALFSNL VEIRLDAIKM VWLQRRLVPR KAKDIGTWLQ 600
    VLETIGVLAV IANGMVIAFT SEFIPRVVYK YRYSPCLKEG NSTVDCLKGY 650
    VNHSLSVFHT KDFQDPDGIE GSENVTLCRY RDYRNPPDYN FSEQFWFLLA 700
    IRLAFVILFE HVALCIKLIA AWFVPDIPQS VKNKVLEVKY QRLREKMWHG 750
    RQRLGGVGAG SRPPMPAHPT PASIFSARST DV 782
    Length:782
    Mass (Da):90,367
    Last modified:March 3, 2009 - v2
    Checksum:iC319076A5C1433FF
    GO
    Isoform 2 (identifier: A1A5B4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-299: Missing.
         300-305: VWDEEQ → MPAVSE

    Show »
    Length:483
    Mass (Da):55,280
    Checksum:i8474676D70D18C37
    GO
    Isoform 3 (identifier: A1A5B4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         156-186: GEGRLKKTWARWRHMFREQPVDEIRNYFGEK → VRGGPAWRGPWGGTLGWGLSLSVTRARGRDA
         187-782: Missing.

    Show »
    Length:186
    Mass (Da):21,096
    Checksum:iE197A8A4E397262F
    GO

    Sequence cautioni

    The sequence BAB84914.1 differs from that shown. Reason: Intron retention.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti93 – 931F → L.2 Publications
    Corresponds to variant rs7395065 [ dbSNP | Ensembl ].
    VAR_054621
    Natural varianti391 – 3911I → V.3 Publications
    Corresponds to variant rs10794324 [ dbSNP | Ensembl ].
    VAR_032617
    Natural varianti399 – 3991C → R.3 Publications
    Corresponds to variant rs10794323 [ dbSNP | Ensembl ].
    VAR_032618

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 299299Missing in isoform 2. 1 PublicationVSP_036489Add
    BLAST
    Alternative sequencei156 – 18631GEGRL…YFGEK → VRGGPAWRGPWGGTLGWGLS LSVTRARGRDA in isoform 3. 1 PublicationVSP_036490Add
    BLAST
    Alternative sequencei187 – 782596Missing in isoform 3. 1 PublicationVSP_036491Add
    BLAST
    Alternative sequencei300 – 3056VWDEEQ → MPAVSE in isoform 2. 1 PublicationVSP_036492

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK074088 mRNA. Translation: BAB84914.1. Sequence problems.
    AK096874 mRNA. Translation: BAG53386.1.
    AK303642 mRNA. Translation: BAG64646.1.
    AC138230 Genomic DNA. No translation available.
    BC128557 mRNA. Translation: AAI28558.1.
    CCDSiCCDS31326.1. [A1A5B4-1]
    RefSeqiNP_001012302.2. NM_001012302.2.
    XP_005252943.1. XM_005252886.1. [A1A5B4-2]
    UniGeneiHs.501622.

    Genome annotation databases

    EnsembliENST00000332826; ENSP00000332788; ENSG00000185101. [A1A5B4-1]
    GeneIDi338440.
    KEGGihsa:338440.
    UCSCiuc001lph.2. human. [A1A5B4-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK074088 mRNA. Translation: BAB84914.1 . Sequence problems.
    AK096874 mRNA. Translation: BAG53386.1 .
    AK303642 mRNA. Translation: BAG64646.1 .
    AC138230 Genomic DNA. No translation available.
    BC128557 mRNA. Translation: AAI28558.1 .
    CCDSi CCDS31326.1. [A1A5B4-1 ]
    RefSeqi NP_001012302.2. NM_001012302.2.
    XP_005252943.1. XM_005252886.1. [A1A5B4-2 ]
    UniGenei Hs.501622.

    3D structure databases

    ProteinModelPortali A1A5B4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi A1A5B4. 1 interaction.

    Protein family/group databases

    TCDBi 1.A.17.1.5. the calcium-dependent chloride channel (ca-clc) family.

    Proteomic databases

    PaxDbi A1A5B4.
    PRIDEi A1A5B4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000332826 ; ENSP00000332788 ; ENSG00000185101 . [A1A5B4-1 ]
    GeneIDi 338440.
    KEGGi hsa:338440.
    UCSCi uc001lph.2. human. [A1A5B4-1 ]

    Organism-specific databases

    CTDi 338440.
    GeneCardsi GC11M000409.
    HGNCi HGNC:20679. ANO9.
    HPAi HPA039948.
    neXtProti NX_A1A5B4.
    PharmGKBi PA164715791.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG327201.
    HOGENOMi HOG000006509.
    HOVERGENi HBG100444.
    InParanoidi A1A5B4.
    OMAi KYHYGPC.
    OrthoDBi EOG776SPC.
    PhylomeDBi A1A5B4.
    TreeFami TF314265.

    Enzyme and pathway databases

    Reactomei REACT_160189. Stimuli-sensing channels.

    Miscellaneous databases

    GenomeRNAii 338440.
    NextBioi 97010.
    PROi A1A5B4.

    Gene expression databases

    Bgeei A1A5B4.
    CleanExi HS_ANO9.
    Genevestigatori A1A5B4.

    Family and domain databases

    InterProi IPR007632. Anoctamin.
    [Graphical view ]
    PANTHERi PTHR12308. PTHR12308. 1 hit.
    Pfami PF04547. Anoctamin. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones."
      Jikuya H., Takano J., Kikuno R., Hirosawa M., Nagase T., Nomura N., Ohara O.
      DNA Res. 10:49-57(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS VAL-391 AND ARG-399.
      Tissue: Spleen.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANTS LEU-93; VAL-391 AND ARG-399.
      Tissue: Salivary gland and Thymus.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS LEU-93; VAL-391 AND ARG-399.
    5. Cited for: FUNCTION, SUBCELLULAR LOCATION.
    6. "Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?"
      Duran C., Hartzell H.C.
      Acta Pharmacol. Sin. 32:685-692(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    7. "CFTR and TMEM16A are separate but functionally related Cl-channels."
      Ousingsawat J., Kongsuphol P., Schreiber R., Kunzelmann K.
      Cell. Physiol. Biochem. 28:715-724(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: ABSENCE OF CALCIUM-ACTIVATED CHLORIDE CHANNEL ACTIVITY.
    8. Cited for: REVIEW.
    9. "The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age."
      Winpenny J.P., Gray M.A.
      Exp. Physiol. 97:175-176(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    10. "The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels."
      Scudieri P., Sondo E., Ferrera L., Galietta L.J.
      Exp. Physiol. 97:177-183(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW, ABSENCE OF CALCIUM-ACTIVATED CHLORIDE CHANNEL ACTIVITY.
    11. "Anoctamins are a family of Ca2+ activated Cl- channels."
      Tian Y., Schreiber R., Kunzelmann K.
      J. Cell Sci. 125:4991-4998(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiANO9_HUMAN
    AccessioniPrimary (citable) accession number: A1A5B4
    Secondary accession number(s): B3KUC4, B4E134, Q8TEN4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: March 3, 2009
    Last modified: October 1, 2014
    This is version 72 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3