Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A1A5B4 (ANO9_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 68. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Anoctamin-9
Alternative name(s):
Transmembrane protein 16J
Tumor protein p53-inducible protein 5
p53-induced gene 5 protein
Gene names
Name:ANO9
Synonyms:PIG5, TMEM16J, TP53I5
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length782 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Does not exhibit calcium-activated chloride channel (CaCC) activity. Can inhibit the activity of ANO1. Ref.5 Ref.11

Subcellular location

Cell membrane; Multi-pass membrane protein. Note: Shows predominantly an intracellular localization with a weak expression in the cell membrane. Ref.5 Ref.11

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

Sequence similarities

Belongs to the anoctamin family.

Sequence caution

The sequence BAB84914.1 differs from that shown. Reason: Intron retention.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A1A5B4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A1A5B4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-299: Missing.
     300-305: VWDEEQ → MPAVSE
Isoform 3 (identifier: A1A5B4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     156-186: GEGRLKKTWARWRHMFREQPVDEIRNYFGEK → VRGGPAWRGPWGGTLGWGLSLSVTRARGRDA
     187-782: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 782782Anoctamin-9
PRO_0000289329

Regions

Topological domain1 – 198198Cytoplasmic Potential
Transmembrane199 – 21921Helical; Potential
Topological domain220 – 26445Extracellular Potential
Transmembrane265 – 28521Helical; Potential
Topological domain286 – 33146Cytoplasmic Potential
Transmembrane332 – 35221Helical; Potential
Topological domain353 – 37321Extracellular Potential
Transmembrane374 – 39421Helical; Potential
Topological domain395 – 42329Cytoplasmic Potential
Transmembrane424 – 44421Helical; Potential
Topological domain445 – 552108Extracellular Potential
Transmembrane553 – 57321Helical; Potential
Topological domain574 – 60431Cytoplasmic Potential
Transmembrane605 – 62521Helical; Potential
Topological domain626 – 70378Extracellular Potential
Transmembrane704 – 72421Helical; Potential
Topological domain725 – 78258Cytoplasmic Potential

Amino acid modifications

Glycosylation6411N-linked (GlcNAc...) Potential
Glycosylation6521N-linked (GlcNAc...) Potential
Glycosylation6741N-linked (GlcNAc...) Potential
Glycosylation6901N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 299299Missing in isoform 2.
VSP_036489
Alternative sequence156 – 18631GEGRL…YFGEK → VRGGPAWRGPWGGTLGWGLS LSVTRARGRDA in isoform 3.
VSP_036490
Alternative sequence187 – 782596Missing in isoform 3.
VSP_036491
Alternative sequence300 – 3056VWDEEQ → MPAVSE in isoform 2.
VSP_036492
Natural variant931F → L. Ref.2 Ref.4
Corresponds to variant rs7395065 [ dbSNP | Ensembl ].
VAR_054621
Natural variant3911I → V. Ref.1 Ref.2 Ref.4
Corresponds to variant rs10794324 [ dbSNP | Ensembl ].
VAR_032617
Natural variant3991C → R. Ref.1 Ref.2 Ref.4
Corresponds to variant rs10794323 [ dbSNP | Ensembl ].
VAR_032618

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 3, 2009. Version 2.
Checksum: C319076A5C1433FF

FASTA78290,367
        10         20         30         40         50         60 
MQGEESLRIL VEPEGDSFPL MEISTCETEA SEQWDYVLVA QRHTQRDPRQ ARQQQFLEEL 

        70         80         90        100        110        120 
RRKGFHIKVI RDQKQVFFGI RADNSVFGLY RTFLLEPEGP APHAELAAPT TIPVTTSLRI 

       130        140        150        160        170        180 
RIVNFVVMNN KTSAGETFED LMKDGVFEAR FPLHKGEGRL KKTWARWRHM FREQPVDEIR 

       190        200        210        220        230        240 
NYFGEKVALY FVWLGWYTYM LVPAALTGLL VFLSGFSLFE ASQISKEICE AHDILMCPLG 

       250        260        270        280        290        300 
DHSRRYQRLS ETCTFAKLTH LFDNDGTVVF AIFMALWATV FLEIWKRQRA RVVLHWDLYV 

       310        320        330        340        350        360 
WDEEQEEMAL QLINCPDYKL RPYQHSYLRS TVILVLTLLM ICLMIGMAHV LVVYRVLASA 

       370        380        390        400        410        420 
LFSSSAVPFL EEQVTTAVVV TGALVHYVTI IIMTKINRCV ALKLCDFEMP RTFSERESRF 

       430        440        450        460        470        480 
TIRFFTLQFF THFSSLIYIA FILGRINGHP GKSTRLAGLW KLEECHASGC MMDLFVQMAI 

       490        500        510        520        530        540 
IMGLKQTLSN CVEYLVPWVT HKCRSLRASE SGHLPRDPEL RDWRRNYLLN PVNTFSLFDE 

       550        560        570        580        590        600 
FMEMMIQYGF TTIFVAAFPL APLLALFSNL VEIRLDAIKM VWLQRRLVPR KAKDIGTWLQ 

       610        620        630        640        650        660 
VLETIGVLAV IANGMVIAFT SEFIPRVVYK YRYSPCLKEG NSTVDCLKGY VNHSLSVFHT 

       670        680        690        700        710        720 
KDFQDPDGIE GSENVTLCRY RDYRNPPDYN FSEQFWFLLA IRLAFVILFE HVALCIKLIA 

       730        740        750        760        770        780 
AWFVPDIPQS VKNKVLEVKY QRLREKMWHG RQRLGGVGAG SRPPMPAHPT PASIFSARST 


DV 

« Hide

Isoform 2 [UniParc].

Checksum: 8474676D70D18C37
Show »

FASTA48355,280
Isoform 3 [UniParc].

Checksum: E197A8A4E397262F
Show »

FASTA18621,096

References

« Hide 'large scale' references
[1]"Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones."
Jikuya H., Takano J., Kikuno R., Hirosawa M., Nagase T., Nomura N., Ohara O.
DNA Res. 10:49-57(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS VAL-391 AND ARG-399.
Tissue: Spleen.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANTS LEU-93; VAL-391 AND ARG-399.
Tissue: Salivary gland and Thymus.
[3]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS LEU-93; VAL-391 AND ARG-399.
[5]"Expression and function of epithelial anoctamins."
Schreiber R., Uliyakina I., Kongsuphol P., Warth R., Mirza M., Martins J.R., Kunzelmann K.
J. Biol. Chem. 285:7838-7845(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION.
[6]"Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?"
Duran C., Hartzell H.C.
Acta Pharmacol. Sin. 32:685-692(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW.
[7]"CFTR and TMEM16A are separate but functionally related Cl-channels."
Ousingsawat J., Kongsuphol P., Schreiber R., Kunzelmann K.
Cell. Physiol. Biochem. 28:715-724(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: ABSENCE OF CALCIUM-ACTIVATED CHLORIDE CHANNEL ACTIVITY.
[8]"Anoctamins."
Kunzelmann K., Tian Y., Martins J.R., Faria D., Kongsuphol P., Ousingsawat J., Thevenod F., Roussa E., Rock J., Schreiber R.
Pflugers Arch. 462:195-208(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW.
[9]"The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age."
Winpenny J.P., Gray M.A.
Exp. Physiol. 97:175-176(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW.
[10]"The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels."
Scudieri P., Sondo E., Ferrera L., Galietta L.J.
Exp. Physiol. 97:177-183(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW, ABSENCE OF CALCIUM-ACTIVATED CHLORIDE CHANNEL ACTIVITY.
[11]"Anoctamins are a family of Ca2+ activated Cl- channels."
Tian Y., Schreiber R., Kunzelmann K.
J. Cell Sci. 125:4991-4998(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK074088 mRNA. Translation: BAB84914.1. Sequence problems.
AK096874 mRNA. Translation: BAG53386.1.
AK303642 mRNA. Translation: BAG64646.1.
AC138230 Genomic DNA. No translation available.
BC128557 mRNA. Translation: AAI28558.1.
RefSeqNP_001012302.2. NM_001012302.2.
XP_005252943.1. XM_005252886.1.
UniGeneHs.501622.

3D structure databases

ProteinModelPortalA1A5B4.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActA1A5B4. 1 interaction.

Protein family/group databases

TCDB1.A.17.1.5. the calcium-dependent chloride channel (ca-clc) family.

Proteomic databases

PaxDbA1A5B4.
PRIDEA1A5B4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000332826; ENSP00000332788; ENSG00000185101. [A1A5B4-1]
GeneID338440.
KEGGhsa:338440.
UCSCuc001lph.2. human. [A1A5B4-1]

Organism-specific databases

CTD338440.
GeneCardsGC11M000409.
HGNCHGNC:20679. ANO9.
HPAHPA039948.
neXtProtNX_A1A5B4.
PharmGKBPA164715791.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG327201.
HOGENOMHOG000006509.
HOVERGENHBG100444.
InParanoidA1A5B4.
OMAKYHYGPC.
OrthoDBEOG776SPC.
PhylomeDBA1A5B4.
TreeFamTF314265.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

BgeeA1A5B4.
CleanExHS_ANO9.
GenevestigatorA1A5B4.

Family and domain databases

InterProIPR007632. Anoctamin.
[Graphical view]
PANTHERPTHR12308. PTHR12308. 1 hit.
PfamPF04547. Anoctamin. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi338440.
NextBio97010.
PROA1A5B4.

Entry information

Entry nameANO9_HUMAN
AccessionPrimary (citable) accession number: A1A5B4
Secondary accession number(s): B3KUC4, B4E134, Q8TEN4
Entry history
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: March 3, 2009
Last modified: April 16, 2014
This is version 68 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM