SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A1A5B4

- ANO9_HUMAN

UniProt

A1A5B4 - ANO9_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Anoctamin-9
Gene
ANO9, PIG5, TMEM16J, TP53I5
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Does not exhibit calcium-activated chloride channel (CaCC) activity. Can inhibit the activity of ANO1.2 Publications

GO - Molecular functioni

  1. intracellular calcium activated chloride channel activity Source: UniProt
Complete GO annotation...

GO - Biological processi

  1. chloride transmembrane transport Source: GOC
  2. chloride transport Source: UniProt
  3. ion transmembrane transport Source: Reactome
  4. negative regulation of intracellular calcium activated chloride channel activity Source: UniProt
  5. transmembrane transport Source: Reactome
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_160189. Stimuli-sensing channels.

Protein family/group databases

TCDBi1.A.17.1.5. the calcium-dependent chloride channel (ca-clc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Anoctamin-9
Alternative name(s):
Transmembrane protein 16J
Tumor protein p53-inducible protein 5
p53-induced gene 5 protein
Gene namesi
Name:ANO9
Synonyms:PIG5, TMEM16J, TP53I5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:20679. ANO9.

Subcellular locationi

Cell membrane; Multi-pass membrane protein
Note: Shows predominantly an intracellular localization with a weak expression in the cell membrane.2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 198198Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei199 – 21921Helical; Reviewed prediction
Add
BLAST
Topological domaini220 – 26445Extracellular Reviewed prediction
Add
BLAST
Transmembranei265 – 28521Helical; Reviewed prediction
Add
BLAST
Topological domaini286 – 33146Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei332 – 35221Helical; Reviewed prediction
Add
BLAST
Topological domaini353 – 37321Extracellular Reviewed prediction
Add
BLAST
Transmembranei374 – 39421Helical; Reviewed prediction
Add
BLAST
Topological domaini395 – 42329Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei424 – 44421Helical; Reviewed prediction
Add
BLAST
Topological domaini445 – 552108Extracellular Reviewed prediction
Add
BLAST
Transmembranei553 – 57321Helical; Reviewed prediction
Add
BLAST
Topological domaini574 – 60431Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei605 – 62521Helical; Reviewed prediction
Add
BLAST
Topological domaini626 – 70378Extracellular Reviewed prediction
Add
BLAST
Transmembranei704 – 72421Helical; Reviewed prediction
Add
BLAST
Topological domaini725 – 78258Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. intracellular Source: Ensembl
  3. plasma membrane Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164715791.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 782782Anoctamin-9
PRO_0000289329Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi641 – 6411N-linked (GlcNAc...) Reviewed prediction
Glycosylationi652 – 6521N-linked (GlcNAc...) Reviewed prediction
Glycosylationi674 – 6741N-linked (GlcNAc...) Reviewed prediction
Glycosylationi690 – 6901N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiA1A5B4.
PRIDEiA1A5B4.

Expressioni

Gene expression databases

BgeeiA1A5B4.
CleanExiHS_ANO9.
GenevestigatoriA1A5B4.

Organism-specific databases

HPAiHPA039948.

Interactioni

Protein-protein interaction databases

IntActiA1A5B4. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliA1A5B4.

Family & Domainsi

Sequence similaritiesi

Belongs to the anoctamin family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG327201.
HOGENOMiHOG000006509.
HOVERGENiHBG100444.
InParanoidiA1A5B4.
OMAiKYHYGPC.
OrthoDBiEOG776SPC.
PhylomeDBiA1A5B4.
TreeFamiTF314265.

Family and domain databases

InterProiIPR007632. Anoctamin.
[Graphical view]
PANTHERiPTHR12308. PTHR12308. 1 hit.
PfamiPF04547. Anoctamin. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A1A5B4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQGEESLRIL VEPEGDSFPL MEISTCETEA SEQWDYVLVA QRHTQRDPRQ    50
ARQQQFLEEL RRKGFHIKVI RDQKQVFFGI RADNSVFGLY RTFLLEPEGP 100
APHAELAAPT TIPVTTSLRI RIVNFVVMNN KTSAGETFED LMKDGVFEAR 150
FPLHKGEGRL KKTWARWRHM FREQPVDEIR NYFGEKVALY FVWLGWYTYM 200
LVPAALTGLL VFLSGFSLFE ASQISKEICE AHDILMCPLG DHSRRYQRLS 250
ETCTFAKLTH LFDNDGTVVF AIFMALWATV FLEIWKRQRA RVVLHWDLYV 300
WDEEQEEMAL QLINCPDYKL RPYQHSYLRS TVILVLTLLM ICLMIGMAHV 350
LVVYRVLASA LFSSSAVPFL EEQVTTAVVV TGALVHYVTI IIMTKINRCV 400
ALKLCDFEMP RTFSERESRF TIRFFTLQFF THFSSLIYIA FILGRINGHP 450
GKSTRLAGLW KLEECHASGC MMDLFVQMAI IMGLKQTLSN CVEYLVPWVT 500
HKCRSLRASE SGHLPRDPEL RDWRRNYLLN PVNTFSLFDE FMEMMIQYGF 550
TTIFVAAFPL APLLALFSNL VEIRLDAIKM VWLQRRLVPR KAKDIGTWLQ 600
VLETIGVLAV IANGMVIAFT SEFIPRVVYK YRYSPCLKEG NSTVDCLKGY 650
VNHSLSVFHT KDFQDPDGIE GSENVTLCRY RDYRNPPDYN FSEQFWFLLA 700
IRLAFVILFE HVALCIKLIA AWFVPDIPQS VKNKVLEVKY QRLREKMWHG 750
RQRLGGVGAG SRPPMPAHPT PASIFSARST DV 782
Length:782
Mass (Da):90,367
Last modified:March 3, 2009 - v2
Checksum:iC319076A5C1433FF
GO
Isoform 2 (identifier: A1A5B4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-299: Missing.
     300-305: VWDEEQ → MPAVSE

Show »
Length:483
Mass (Da):55,280
Checksum:i8474676D70D18C37
GO
Isoform 3 (identifier: A1A5B4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-186: GEGRLKKTWARWRHMFREQPVDEIRNYFGEK → VRGGPAWRGPWGGTLGWGLSLSVTRARGRDA
     187-782: Missing.

Show »
Length:186
Mass (Da):21,096
Checksum:iE197A8A4E397262F
GO

Sequence cautioni

The sequence BAB84914.1 differs from that shown. Reason: Intron retention.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti93 – 931F → L.2 Publications
Corresponds to variant rs7395065 [ dbSNP | Ensembl ].
VAR_054621
Natural varianti391 – 3911I → V.3 Publications
Corresponds to variant rs10794324 [ dbSNP | Ensembl ].
VAR_032617
Natural varianti399 – 3991C → R.3 Publications
Corresponds to variant rs10794323 [ dbSNP | Ensembl ].
VAR_032618

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 299299Missing in isoform 2.
VSP_036489Add
BLAST
Alternative sequencei156 – 18631GEGRL…YFGEK → VRGGPAWRGPWGGTLGWGLS LSVTRARGRDA in isoform 3.
VSP_036490Add
BLAST
Alternative sequencei187 – 782596Missing in isoform 3.
VSP_036491Add
BLAST
Alternative sequencei300 – 3056VWDEEQ → MPAVSE in isoform 2.
VSP_036492

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK074088 mRNA. Translation: BAB84914.1. Sequence problems.
AK096874 mRNA. Translation: BAG53386.1.
AK303642 mRNA. Translation: BAG64646.1.
AC138230 Genomic DNA. No translation available.
BC128557 mRNA. Translation: AAI28558.1.
CCDSiCCDS31326.1. [A1A5B4-1]
RefSeqiNP_001012302.2. NM_001012302.2.
XP_005252943.1. XM_005252886.1. [A1A5B4-2]
UniGeneiHs.501622.

Genome annotation databases

EnsembliENST00000332826; ENSP00000332788; ENSG00000185101. [A1A5B4-1]
GeneIDi338440.
KEGGihsa:338440.
UCSCiuc001lph.2. human. [A1A5B4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK074088 mRNA. Translation: BAB84914.1 . Sequence problems.
AK096874 mRNA. Translation: BAG53386.1 .
AK303642 mRNA. Translation: BAG64646.1 .
AC138230 Genomic DNA. No translation available.
BC128557 mRNA. Translation: AAI28558.1 .
CCDSi CCDS31326.1. [A1A5B4-1 ]
RefSeqi NP_001012302.2. NM_001012302.2.
XP_005252943.1. XM_005252886.1. [A1A5B4-2 ]
UniGenei Hs.501622.

3D structure databases

ProteinModelPortali A1A5B4.
ModBasei Search...

Protein-protein interaction databases

IntActi A1A5B4. 1 interaction.

Protein family/group databases

TCDBi 1.A.17.1.5. the calcium-dependent chloride channel (ca-clc) family.

Proteomic databases

PaxDbi A1A5B4.
PRIDEi A1A5B4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000332826 ; ENSP00000332788 ; ENSG00000185101 . [A1A5B4-1 ]
GeneIDi 338440.
KEGGi hsa:338440.
UCSCi uc001lph.2. human. [A1A5B4-1 ]

Organism-specific databases

CTDi 338440.
GeneCardsi GC11M000409.
HGNCi HGNC:20679. ANO9.
HPAi HPA039948.
neXtProti NX_A1A5B4.
PharmGKBi PA164715791.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG327201.
HOGENOMi HOG000006509.
HOVERGENi HBG100444.
InParanoidi A1A5B4.
OMAi KYHYGPC.
OrthoDBi EOG776SPC.
PhylomeDBi A1A5B4.
TreeFami TF314265.

Enzyme and pathway databases

Reactomei REACT_160189. Stimuli-sensing channels.

Miscellaneous databases

GenomeRNAii 338440.
NextBioi 97010.
PROi A1A5B4.

Gene expression databases

Bgeei A1A5B4.
CleanExi HS_ANO9.
Genevestigatori A1A5B4.

Family and domain databases

InterProi IPR007632. Anoctamin.
[Graphical view ]
PANTHERi PTHR12308. PTHR12308. 1 hit.
Pfami PF04547. Anoctamin. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones."
    Jikuya H., Takano J., Kikuno R., Hirosawa M., Nagase T., Nomura N., Ohara O.
    DNA Res. 10:49-57(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS VAL-391 AND ARG-399.
    Tissue: Spleen.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANTS LEU-93; VAL-391 AND ARG-399.
    Tissue: Salivary gland and Thymus.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS LEU-93; VAL-391 AND ARG-399.
  5. Cited for: FUNCTION, SUBCELLULAR LOCATION.
  6. "Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?"
    Duran C., Hartzell H.C.
    Acta Pharmacol. Sin. 32:685-692(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  7. "CFTR and TMEM16A are separate but functionally related Cl-channels."
    Ousingsawat J., Kongsuphol P., Schreiber R., Kunzelmann K.
    Cell. Physiol. Biochem. 28:715-724(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: ABSENCE OF CALCIUM-ACTIVATED CHLORIDE CHANNEL ACTIVITY.
  8. Cited for: REVIEW.
  9. "The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age."
    Winpenny J.P., Gray M.A.
    Exp. Physiol. 97:175-176(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  10. "The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels."
    Scudieri P., Sondo E., Ferrera L., Galietta L.J.
    Exp. Physiol. 97:177-183(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW, ABSENCE OF CALCIUM-ACTIVATED CHLORIDE CHANNEL ACTIVITY.
  11. "Anoctamins are a family of Ca2+ activated Cl- channels."
    Tian Y., Schreiber R., Kunzelmann K.
    J. Cell Sci. 125:4991-4998(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiANO9_HUMAN
AccessioniPrimary (citable) accession number: A1A5B4
Secondary accession number(s): B3KUC4, B4E134, Q8TEN4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: March 3, 2009
Last modified: September 3, 2014
This is version 71 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi