Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Anoctamin-9

Gene

ANO9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide (By similarity). Does not exhibit calcium-activated chloride channel (CaCC) activity. Can inhibit the activity of ANO1.By similarity2 Publications

GO - Molecular functioni

  • intracellular calcium activated chloride channel activity Source: UniProtKB
  • phospholipid scramblase activity Source: Ensembl

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-2672351. Stimuli-sensing channels.

Protein family/group databases

TCDBi1.A.17.1.5. the calcium-dependent chloride channel (ca-clc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Anoctamin-9
Alternative name(s):
Transmembrane protein 16J
Tumor protein p53-inducible protein 5
p53-induced gene 5 protein
Gene namesi
Name:ANO9
Synonyms:PIG5, TMEM16J, TP53I5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:20679. ANO9.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 198CytoplasmicSequence analysisAdd BLAST198
Transmembranei199 – 219HelicalSequence analysisAdd BLAST21
Topological domaini220 – 264ExtracellularSequence analysisAdd BLAST45
Transmembranei265 – 285HelicalSequence analysisAdd BLAST21
Topological domaini286 – 331CytoplasmicSequence analysisAdd BLAST46
Transmembranei332 – 352HelicalSequence analysisAdd BLAST21
Topological domaini353 – 373ExtracellularSequence analysisAdd BLAST21
Transmembranei374 – 394HelicalSequence analysisAdd BLAST21
Topological domaini395 – 423CytoplasmicSequence analysisAdd BLAST29
Transmembranei424 – 444HelicalSequence analysisAdd BLAST21
Topological domaini445 – 552ExtracellularSequence analysisAdd BLAST108
Transmembranei553 – 573HelicalSequence analysisAdd BLAST21
Topological domaini574 – 604CytoplasmicSequence analysisAdd BLAST31
Transmembranei605 – 625HelicalSequence analysisAdd BLAST21
Topological domaini626 – 703ExtracellularSequence analysisAdd BLAST78
Transmembranei704 – 724HelicalSequence analysisAdd BLAST21
Topological domaini725 – 782CytoplasmicSequence analysisAdd BLAST58

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • intracellular Source: Ensembl
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi338440.
OpenTargetsiENSG00000185101.
PharmGKBiPA164715791.

Polymorphism and mutation databases

BioMutaiANO9.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002893291 – 782Anoctamin-9Add BLAST782

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi641N-linked (GlcNAc...)Sequence analysis1
Glycosylationi652N-linked (GlcNAc...)Sequence analysis1
Glycosylationi674N-linked (GlcNAc...)Sequence analysis1
Glycosylationi690N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiA1A5B4.
PRIDEiA1A5B4.

PTM databases

iPTMnetiA1A5B4.
PhosphoSitePlusiA1A5B4.

Expressioni

Gene expression databases

BgeeiENSG00000185101.
CleanExiHS_ANO9.
GenevisibleiA1A5B4. HS.

Organism-specific databases

HPAiHPA039948.

Interactioni

Protein-protein interaction databases

IntActiA1A5B4. 1 interactor.
STRINGi9606.ENSP00000332788.

Structurei

3D structure databases

ProteinModelPortaliA1A5B4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the anoctamin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2514. Eukaryota.
ENOG410XS4S. LUCA.
GeneTreeiENSGT00760000119015.
HOGENOMiHOG000006509.
HOVERGENiHBG100444.
InParanoidiA1A5B4.
KOiK19503.
OMAiKYHYGPC.
OrthoDBiEOG091G02JM.
TreeFamiTF314265.

Family and domain databases

InterProiIPR007632. Anoctamin.
IPR031290. Anoctamin-9.
[Graphical view]
PANTHERiPTHR12308. PTHR12308. 1 hit.
PTHR12308:SF37. PTHR12308:SF37. 1 hit.
PfamiPF04547. Anoctamin. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A1A5B4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQGEESLRIL VEPEGDSFPL MEISTCETEA SEQWDYVLVA QRHTQRDPRQ
60 70 80 90 100
ARQQQFLEEL RRKGFHIKVI RDQKQVFFGI RADNSVFGLY RTLLLEPEGP
110 120 130 140 150
APHAELAAPT TIPVTTSLRI RIVNFVVMNN KTSAGETFED LMKDGVFEAR
160 170 180 190 200
FPLHKGEGRL KKTWARWRHM FREQPVDEIR NYFGEKVALY FVWLGWYTYM
210 220 230 240 250
LVPAALTGLL VFLSGFSLFE ASQISKEICE AHDILMCPLG DHSRRYQRLS
260 270 280 290 300
ETCTFAKLTH LFDNDGTVVF AIFMALWATV FLEIWKRQRA RVVLHWDLYV
310 320 330 340 350
WDEEQEEMAL QLINCPDYKL RPYQHSYLRS TVILVLTLLM ICLMIGMAHV
360 370 380 390 400
LVVYRVLASA LFSSSAVPFL EEQVTTAVVV TGALVHYVTI IIMTKINRCV
410 420 430 440 450
ALKLCDFEMP RTFSERESRF TIRFFTLQFF THFSSLIYIA FILGRINGHP
460 470 480 490 500
GKSTRLAGLW KLEECHASGC MMDLFVQMAI IMGLKQTLSN CVEYLVPWVT
510 520 530 540 550
HKCRSLRASE SGHLPRDPEL RDWRRNYLLN PVNTFSLFDE FMEMMIQYGF
560 570 580 590 600
TTIFVAAFPL APLLALFSNL VEIRLDAIKM VWLQRRLVPR KAKDIGTWLQ
610 620 630 640 650
VLETIGVLAV IANGMVIAFT SEFIPRVVYK YRYSPCLKEG NSTVDCLKGY
660 670 680 690 700
VNHSLSVFHT KDFQDPDGIE GSENVTLCRY RDYRNPPDYN FSEQFWFLLA
710 720 730 740 750
IRLAFVILFE HVALCIKLIA AWFVPDIPQS VKNKVLEVKY QRLREKMWHG
760 770 780
RQRLGGVGAG SRPPMPAHPT PASIFSARST DV
Length:782
Mass (Da):90,333
Last modified:May 27, 2015 - v3
Checksum:i6A359B63DD92AFF7
GO
Isoform 2 (identifier: A1A5B4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-299: Missing.
     300-305: VWDEEQ → MPAVSE

Show »
Length:483
Mass (Da):55,280
Checksum:i8474676D70D18C37
GO
Isoform 3 (identifier: A1A5B4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-186: GEGRLKKTWARWRHMFREQPVDEIRNYFGEK → VRGGPAWRGPWGGTLGWGLSLSVTRARGRDA
     187-782: Missing.

Show »
Length:186
Mass (Da):21,062
Checksum:i0F7746A4039D8C25
GO

Sequence cautioni

The sequence BAB84914 differs from that shown. Intron retention.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05462193L → F.2 PublicationsCorresponds to variant rs7395065dbSNPEnsembl.1
Natural variantiVAR_032617391I → V.3 PublicationsCorresponds to variant rs10794324dbSNPEnsembl.1
Natural variantiVAR_032618399C → R.3 PublicationsCorresponds to variant rs10794323dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0364891 – 299Missing in isoform 2. 1 PublicationAdd BLAST299
Alternative sequenceiVSP_036490156 – 186GEGRL…YFGEK → VRGGPAWRGPWGGTLGWGLS LSVTRARGRDA in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_036491187 – 782Missing in isoform 3. 1 PublicationAdd BLAST596
Alternative sequenceiVSP_036492300 – 305VWDEEQ → MPAVSE in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK074088 mRNA. Translation: BAB84914.1. Sequence problems.
AK096874 mRNA. Translation: BAG53386.1.
AK303642 mRNA. Translation: BAG64646.1.
AC138230 Genomic DNA. No translation available.
BC128557 mRNA. Translation: AAI28558.1.
CCDSiCCDS31326.1. [A1A5B4-1]
RefSeqiNP_001012302.2. NM_001012302.2. [A1A5B4-1]
XP_011518355.1. XM_011520053.2. [A1A5B4-2]
UniGeneiHs.501622.

Genome annotation databases

EnsembliENST00000332826; ENSP00000332788; ENSG00000185101. [A1A5B4-1]
GeneIDi338440.
KEGGihsa:338440.
UCSCiuc001lpi.3. human. [A1A5B4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK074088 mRNA. Translation: BAB84914.1. Sequence problems.
AK096874 mRNA. Translation: BAG53386.1.
AK303642 mRNA. Translation: BAG64646.1.
AC138230 Genomic DNA. No translation available.
BC128557 mRNA. Translation: AAI28558.1.
CCDSiCCDS31326.1. [A1A5B4-1]
RefSeqiNP_001012302.2. NM_001012302.2. [A1A5B4-1]
XP_011518355.1. XM_011520053.2. [A1A5B4-2]
UniGeneiHs.501622.

3D structure databases

ProteinModelPortaliA1A5B4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiA1A5B4. 1 interactor.
STRINGi9606.ENSP00000332788.

Protein family/group databases

TCDBi1.A.17.1.5. the calcium-dependent chloride channel (ca-clc) family.

PTM databases

iPTMnetiA1A5B4.
PhosphoSitePlusiA1A5B4.

Polymorphism and mutation databases

BioMutaiANO9.

Proteomic databases

PaxDbiA1A5B4.
PRIDEiA1A5B4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000332826; ENSP00000332788; ENSG00000185101. [A1A5B4-1]
GeneIDi338440.
KEGGihsa:338440.
UCSCiuc001lpi.3. human. [A1A5B4-1]

Organism-specific databases

CTDi338440.
DisGeNETi338440.
GeneCardsiANO9.
HGNCiHGNC:20679. ANO9.
HPAiHPA039948.
neXtProtiNX_A1A5B4.
OpenTargetsiENSG00000185101.
PharmGKBiPA164715791.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2514. Eukaryota.
ENOG410XS4S. LUCA.
GeneTreeiENSGT00760000119015.
HOGENOMiHOG000006509.
HOVERGENiHBG100444.
InParanoidiA1A5B4.
KOiK19503.
OMAiKYHYGPC.
OrthoDBiEOG091G02JM.
TreeFamiTF314265.

Enzyme and pathway databases

ReactomeiR-HSA-2672351. Stimuli-sensing channels.

Miscellaneous databases

ChiTaRSiANO9. human.
GenomeRNAii338440.
PROiA1A5B4.

Gene expression databases

BgeeiENSG00000185101.
CleanExiHS_ANO9.
GenevisibleiA1A5B4. HS.

Family and domain databases

InterProiIPR007632. Anoctamin.
IPR031290. Anoctamin-9.
[Graphical view]
PANTHERiPTHR12308. PTHR12308. 1 hit.
PTHR12308:SF37. PTHR12308:SF37. 1 hit.
PfamiPF04547. Anoctamin. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiANO9_HUMAN
AccessioniPrimary (citable) accession number: A1A5B4
Secondary accession number(s): B3KUC4, B4E134, Q8TEN4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 27, 2015
Last modified: November 2, 2016
This is version 91 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.