Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A1A5B4

- ANO9_HUMAN

UniProt

A1A5B4 - ANO9_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Anoctamin-9

Gene

ANO9

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide (By similarity). Does not exhibit calcium-activated chloride channel (CaCC) activity. Can inhibit the activity of ANO1.By similarity2 Publications

GO - Molecular functioni

  1. intracellular calcium activated chloride channel activity Source: UniProt
  2. phospholipid scramblase activity Source: Ensembl

GO - Biological processi

  1. calcium activated galactosylceramide scrambling Source: Ensembl
  2. calcium activated phosphatidylcholine scrambling Source: Ensembl
  3. calcium activated phosphatidylserine scrambling Source: Ensembl
  4. chloride transmembrane transport Source: GOC
  5. chloride transport Source: UniProt
  6. ion transmembrane transport Source: Reactome
  7. negative regulation of intracellular calcium activated chloride channel activity Source: UniProt
  8. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Enzyme and pathway databases

ReactomeiREACT_160189. Stimuli-sensing channels.

Protein family/group databases

TCDBi1.A.17.1.5. the calcium-dependent chloride channel (ca-clc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Anoctamin-9
Alternative name(s):
Transmembrane protein 16J
Tumor protein p53-inducible protein 5
p53-induced gene 5 protein
Gene namesi
Name:ANO9
Synonyms:PIG5, TMEM16J, TP53I5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:20679. ANO9.

Subcellular locationi

Cell membrane 2 Publications; Multi-pass membrane protein 2 Publications
Note: Shows predominantly an intracellular localization with a weak expression in the cell membrane.

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. intracellular Source: Ensembl
  3. plasma membrane Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164715791.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 782782Anoctamin-9PRO_0000289329Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi641 – 6411N-linked (GlcNAc...)Sequence Analysis
Glycosylationi652 – 6521N-linked (GlcNAc...)Sequence Analysis
Glycosylationi674 – 6741N-linked (GlcNAc...)Sequence Analysis
Glycosylationi690 – 6901N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiA1A5B4.
PRIDEiA1A5B4.

Expressioni

Gene expression databases

BgeeiA1A5B4.
CleanExiHS_ANO9.
GenevestigatoriA1A5B4.

Organism-specific databases

HPAiHPA039948.

Interactioni

Protein-protein interaction databases

IntActiA1A5B4. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliA1A5B4.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 198198CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini220 – 26445ExtracellularSequence AnalysisAdd
BLAST
Topological domaini286 – 33146CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini353 – 37321ExtracellularSequence AnalysisAdd
BLAST
Topological domaini395 – 42329CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini445 – 552108ExtracellularSequence AnalysisAdd
BLAST
Topological domaini574 – 60431CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini626 – 70378ExtracellularSequence AnalysisAdd
BLAST
Topological domaini725 – 78258CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei199 – 21921HelicalSequence AnalysisAdd
BLAST
Transmembranei265 – 28521HelicalSequence AnalysisAdd
BLAST
Transmembranei332 – 35221HelicalSequence AnalysisAdd
BLAST
Transmembranei374 – 39421HelicalSequence AnalysisAdd
BLAST
Transmembranei424 – 44421HelicalSequence AnalysisAdd
BLAST
Transmembranei553 – 57321HelicalSequence AnalysisAdd
BLAST
Transmembranei605 – 62521HelicalSequence AnalysisAdd
BLAST
Transmembranei704 – 72421HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the anoctamin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG327201.
HOGENOMiHOG000006509.
HOVERGENiHBG100444.
InParanoidiA1A5B4.
OMAiKYHYGPC.
OrthoDBiEOG776SPC.
PhylomeDBiA1A5B4.
TreeFamiTF314265.

Family and domain databases

InterProiIPR007632. Anoctamin.
[Graphical view]
PANTHERiPTHR12308. PTHR12308. 1 hit.
PfamiPF04547. Anoctamin. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A1A5B4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQGEESLRIL VEPEGDSFPL MEISTCETEA SEQWDYVLVA QRHTQRDPRQ
60 70 80 90 100
ARQQQFLEEL RRKGFHIKVI RDQKQVFFGI RADNSVFGLY RTFLLEPEGP
110 120 130 140 150
APHAELAAPT TIPVTTSLRI RIVNFVVMNN KTSAGETFED LMKDGVFEAR
160 170 180 190 200
FPLHKGEGRL KKTWARWRHM FREQPVDEIR NYFGEKVALY FVWLGWYTYM
210 220 230 240 250
LVPAALTGLL VFLSGFSLFE ASQISKEICE AHDILMCPLG DHSRRYQRLS
260 270 280 290 300
ETCTFAKLTH LFDNDGTVVF AIFMALWATV FLEIWKRQRA RVVLHWDLYV
310 320 330 340 350
WDEEQEEMAL QLINCPDYKL RPYQHSYLRS TVILVLTLLM ICLMIGMAHV
360 370 380 390 400
LVVYRVLASA LFSSSAVPFL EEQVTTAVVV TGALVHYVTI IIMTKINRCV
410 420 430 440 450
ALKLCDFEMP RTFSERESRF TIRFFTLQFF THFSSLIYIA FILGRINGHP
460 470 480 490 500
GKSTRLAGLW KLEECHASGC MMDLFVQMAI IMGLKQTLSN CVEYLVPWVT
510 520 530 540 550
HKCRSLRASE SGHLPRDPEL RDWRRNYLLN PVNTFSLFDE FMEMMIQYGF
560 570 580 590 600
TTIFVAAFPL APLLALFSNL VEIRLDAIKM VWLQRRLVPR KAKDIGTWLQ
610 620 630 640 650
VLETIGVLAV IANGMVIAFT SEFIPRVVYK YRYSPCLKEG NSTVDCLKGY
660 670 680 690 700
VNHSLSVFHT KDFQDPDGIE GSENVTLCRY RDYRNPPDYN FSEQFWFLLA
710 720 730 740 750
IRLAFVILFE HVALCIKLIA AWFVPDIPQS VKNKVLEVKY QRLREKMWHG
760 770 780
RQRLGGVGAG SRPPMPAHPT PASIFSARST DV
Length:782
Mass (Da):90,367
Last modified:March 3, 2009 - v2
Checksum:iC319076A5C1433FF
GO
Isoform 2 (identifier: A1A5B4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-299: Missing.
     300-305: VWDEEQ → MPAVSE

Show »
Length:483
Mass (Da):55,280
Checksum:i8474676D70D18C37
GO
Isoform 3 (identifier: A1A5B4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-186: GEGRLKKTWARWRHMFREQPVDEIRNYFGEK → VRGGPAWRGPWGGTLGWGLSLSVTRARGRDA
     187-782: Missing.

Show »
Length:186
Mass (Da):21,096
Checksum:iE197A8A4E397262F
GO

Sequence cautioni

The sequence BAB84914.1 differs from that shown. Reason: Intron retention.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti93 – 931F → L.2 Publications
Corresponds to variant rs7395065 [ dbSNP | Ensembl ].
VAR_054621
Natural varianti391 – 3911I → V.3 Publications
Corresponds to variant rs10794324 [ dbSNP | Ensembl ].
VAR_032617
Natural varianti399 – 3991C → R.3 Publications
Corresponds to variant rs10794323 [ dbSNP | Ensembl ].
VAR_032618

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 299299Missing in isoform 2. 1 PublicationVSP_036489Add
BLAST
Alternative sequencei156 – 18631GEGRL…YFGEK → VRGGPAWRGPWGGTLGWGLS LSVTRARGRDA in isoform 3. 1 PublicationVSP_036490Add
BLAST
Alternative sequencei187 – 782596Missing in isoform 3. 1 PublicationVSP_036491Add
BLAST
Alternative sequencei300 – 3056VWDEEQ → MPAVSE in isoform 2. 1 PublicationVSP_036492

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK074088 mRNA. Translation: BAB84914.1. Sequence problems.
AK096874 mRNA. Translation: BAG53386.1.
AK303642 mRNA. Translation: BAG64646.1.
AC138230 Genomic DNA. No translation available.
BC128557 mRNA. Translation: AAI28558.1.
CCDSiCCDS31326.1. [A1A5B4-1]
RefSeqiNP_001012302.2. NM_001012302.2.
XP_005252943.1. XM_005252886.1. [A1A5B4-2]
UniGeneiHs.501622.

Genome annotation databases

EnsembliENST00000332826; ENSP00000332788; ENSG00000185101.
GeneIDi338440.
KEGGihsa:338440.
UCSCiuc001lph.2. human. [A1A5B4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK074088 mRNA. Translation: BAB84914.1 . Sequence problems.
AK096874 mRNA. Translation: BAG53386.1 .
AK303642 mRNA. Translation: BAG64646.1 .
AC138230 Genomic DNA. No translation available.
BC128557 mRNA. Translation: AAI28558.1 .
CCDSi CCDS31326.1. [A1A5B4-1 ]
RefSeqi NP_001012302.2. NM_001012302.2.
XP_005252943.1. XM_005252886.1. [A1A5B4-2 ]
UniGenei Hs.501622.

3D structure databases

ProteinModelPortali A1A5B4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi A1A5B4. 1 interaction.

Protein family/group databases

TCDBi 1.A.17.1.5. the calcium-dependent chloride channel (ca-clc) family.

Proteomic databases

PaxDbi A1A5B4.
PRIDEi A1A5B4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000332826 ; ENSP00000332788 ; ENSG00000185101 .
GeneIDi 338440.
KEGGi hsa:338440.
UCSCi uc001lph.2. human. [A1A5B4-1 ]

Organism-specific databases

CTDi 338440.
GeneCardsi GC11M000409.
HGNCi HGNC:20679. ANO9.
HPAi HPA039948.
neXtProti NX_A1A5B4.
PharmGKBi PA164715791.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG327201.
HOGENOMi HOG000006509.
HOVERGENi HBG100444.
InParanoidi A1A5B4.
OMAi KYHYGPC.
OrthoDBi EOG776SPC.
PhylomeDBi A1A5B4.
TreeFami TF314265.

Enzyme and pathway databases

Reactomei REACT_160189. Stimuli-sensing channels.

Miscellaneous databases

GenomeRNAii 338440.
NextBioi 97010.
PROi A1A5B4.

Gene expression databases

Bgeei A1A5B4.
CleanExi HS_ANO9.
Genevestigatori A1A5B4.

Family and domain databases

InterProi IPR007632. Anoctamin.
[Graphical view ]
PANTHERi PTHR12308. PTHR12308. 1 hit.
Pfami PF04547. Anoctamin. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones."
    Jikuya H., Takano J., Kikuno R., Hirosawa M., Nagase T., Nomura N., Ohara O.
    DNA Res. 10:49-57(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS VAL-391 AND ARG-399.
    Tissue: Spleen.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANTS LEU-93; VAL-391 AND ARG-399.
    Tissue: Salivary gland and Thymus.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS LEU-93; VAL-391 AND ARG-399.
  5. Cited for: FUNCTION, SUBCELLULAR LOCATION.
  6. "Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?"
    Duran C., Hartzell H.C.
    Acta Pharmacol. Sin. 32:685-692(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  7. "CFTR and TMEM16A are separate but functionally related Cl-channels."
    Ousingsawat J., Kongsuphol P., Schreiber R., Kunzelmann K.
    Cell. Physiol. Biochem. 28:715-724(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: ABSENCE OF CALCIUM-ACTIVATED CHLORIDE CHANNEL ACTIVITY.
  8. Cited for: REVIEW.
  9. "The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age."
    Winpenny J.P., Gray M.A.
    Exp. Physiol. 97:175-176(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  10. "The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels."
    Scudieri P., Sondo E., Ferrera L., Galietta L.J.
    Exp. Physiol. 97:177-183(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW, ABSENCE OF CALCIUM-ACTIVATED CHLORIDE CHANNEL ACTIVITY.
  11. "Anoctamins are a family of Ca2+ activated Cl- channels."
    Tian Y., Schreiber R., Kunzelmann K.
    J. Cell Sci. 125:4991-4998(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiANO9_HUMAN
AccessioniPrimary (citable) accession number: A1A5B4
Secondary accession number(s): B3KUC4, B4E134, Q8TEN4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: March 3, 2009
Last modified: October 29, 2014
This is version 73 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3