Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM170A

Gene

FAM170A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Acts as a nuclear transcription factor that positively regulates the expression of heat shock genes. Binds to heat shock promoter elements (HSE).1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri228 – 25225C2H2-type; degenerateAdd
BLAST

GO - Molecular functioni

GO - Biological processi

  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • transcription from RNA polymerase II promoter Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM170A
Alternative name(s):
Zinc finger domain-containing protein
Zinc finger protein ZNFD
Gene namesi
Name:FAM170A
Synonyms:ZNFD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:27963. FAM170A.

Subcellular locationi

GO - Cellular componenti

  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162387167.

Polymorphism and mutation databases

BioMutaiFAM170A.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 330330Protein FAM170APRO_0000326110Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei217 – 2171PhosphothreonineBy similarity
Modified residuei315 – 3151PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiA1A519.
PRIDEiA1A519.

PTM databases

iPTMnetiA1A519.
PhosphoSiteiA1A519.

Expressioni

Tissue specificityi

Expressed strongly in testis and brain and weakly in prostate, spleen, pancreas and uterus.1 Publication

Gene expression databases

BgeeiENSG00000164334.
CleanExiHS_FAM170A.
ExpressionAtlasiA1A519. baseline and differential.
GenevisibleiA1A519. HS.

Organism-specific databases

HPAiHPA037900.
HPA037901.
HPA037902.

Interactioni

Protein-protein interaction databases

BioGridi130989. 14 interactions.

Structurei

3D structure databases

ProteinModelPortaliA1A519.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi272 – 30635Glu-richAdd
BLAST

Domaini

The N-terminus is necessary for nuclear localization. The C-terminus is necessary for transcriptional activity.

Sequence similaritiesi

Belongs to the FAM170 family.Curated
Contains 1 C2H2-type zinc finger.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri228 – 25225C2H2-type; degenerateAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiENOG410IGZX. Eukaryota.
ENOG4111C5N. LUCA.
GeneTreeiENSGT00530000063963.
HOGENOMiHOG000050239.
HOVERGENiHBG060499.
InParanoidiA1A519.
OMAiCHVFHLT.
OrthoDBiEOG091G1ATE.
PhylomeDBiA1A519.
TreeFamiTF337124.

Family and domain databases

InterProiIPR033376. FAM170A.
[Graphical view]
PANTHERiPTHR33517:SF3. PTHR33517:SF3. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A1A519-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKRRQKRKHL ENEESQETAE KGGGMSKSQE DALQPGSTRV AKGWSQGVGE
60 70 80 90 100
VTSTSEYCSC VSSSRKLIHS GIQRIHRDSP QPQSPLAQVQ ERGETPPRSQ
110 120 130 140 150
HVSLSSYSSY KTCVSSLCVN KEERGMKIYY MQVQMNKGVA VSWETEETLE
160 170 180 190 200
SLEKQPRMEE VTLSEVVRVG TPPSDVSTRN LLSDSEPSGE EKEHEERTES
210 220 230 240 250
DSLPGSPTVE DTPRAKTPDW LVTMENGFRC MACCRVFTTM EALQEHVQFG
260 270 280 290 300
IREGFSCHVF HLTMAQLTGN MESESTQDEQ EEENGNEKEE EEKPEAKEEE
310 320 330
GQPTEEDLGL RRSWSQCPGC VFHSPKDRNS
Length:330
Mass (Da):37,158
Last modified:January 23, 2007 - v1
Checksum:iDAE7F2D1E96D90AD
GO
Isoform 2 (identifier: A1A519-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     330-330: Missing.

Show »
Length:329
Mass (Da):37,071
Checksum:i37F2D1E96D90ADD0
GO
Isoform 3 (identifier: A1A519-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-70: Missing.
     330-330: Missing.

Show »
Length:282
Mass (Da):32,141
Checksum:i180D027ADCAE164B
GO
Isoform 4 (identifier: A1A519-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-71: Missing.
     258-291: HVFHLTMAQLTGNMESESTQDEQEEENGNEKEEE → PKMSRRRKMEMRRRRKRNQKQRRRRGSPQKKTLA
     292-330: Missing.

Note: No experimental confirmation available.
Show »
Length:244
Mass (Da):28,231
Checksum:i8DBA5A1B1AC7031B
GO

Sequence cautioni

The sequence AAH40622 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti173 – 1731P → S.
Corresponds to variant rs328694 [ dbSNP | Ensembl ].
VAR_047312

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei24 – 7047Missing in isoform 3. 1 PublicationVSP_032556Add
BLAST
Alternative sequencei25 – 7147Missing in isoform 4. 1 PublicationVSP_035475Add
BLAST
Alternative sequencei258 – 29134HVFHL…EKEEE → PKMSRRRKMEMRRRRKRNQK QRRRRGSPQKKTLA in isoform 4. 1 PublicationVSP_035476Add
BLAST
Alternative sequencei292 – 33039Missing in isoform 4. 1 PublicationVSP_035477Add
BLAST
Alternative sequencei330 – 3301Missing in isoform 2 and isoform 3. 3 PublicationsVSP_032557

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY692447 mRNA. Translation: AAU04855.1.
AF427126 mRNA. Translation: AAP97296.1.
AC010409 Genomic DNA. No translation available.
BC040622 mRNA. Translation: AAH40622.1. Different initiation.
BC128243 mRNA. Translation: AAI28244.1.
CCDSiCCDS43353.1. [A1A519-2]
CCDS54889.1. [A1A519-3]
RefSeqiNP_001157463.1. NM_001163991.1. [A1A519-3]
NP_877438.2. NM_182761.3. [A1A519-2]
UniGeneiHs.713304.

Genome annotation databases

EnsembliENST00000335286; ENSP00000334285; ENSG00000164334. [A1A519-2]
ENST00000379555; ENSP00000368873; ENSG00000164334. [A1A519-3]
ENST00000515256; ENSP00000422684; ENSG00000164334. [A1A519-1]
ENST00000613773; ENSP00000482552; ENSG00000164334. [A1A519-2]
ENST00000620555; ENSP00000483075; ENSG00000164334. [A1A519-3]
GeneIDi340069.
KEGGihsa:340069.
UCSCiuc003ksm.3. human. [A1A519-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY692447 mRNA. Translation: AAU04855.1.
AF427126 mRNA. Translation: AAP97296.1.
AC010409 Genomic DNA. No translation available.
BC040622 mRNA. Translation: AAH40622.1. Different initiation.
BC128243 mRNA. Translation: AAI28244.1.
CCDSiCCDS43353.1. [A1A519-2]
CCDS54889.1. [A1A519-3]
RefSeqiNP_001157463.1. NM_001163991.1. [A1A519-3]
NP_877438.2. NM_182761.3. [A1A519-2]
UniGeneiHs.713304.

3D structure databases

ProteinModelPortaliA1A519.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130989. 14 interactions.

PTM databases

iPTMnetiA1A519.
PhosphoSiteiA1A519.

Polymorphism and mutation databases

BioMutaiFAM170A.

Proteomic databases

PaxDbiA1A519.
PRIDEiA1A519.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335286; ENSP00000334285; ENSG00000164334. [A1A519-2]
ENST00000379555; ENSP00000368873; ENSG00000164334. [A1A519-3]
ENST00000515256; ENSP00000422684; ENSG00000164334. [A1A519-1]
ENST00000613773; ENSP00000482552; ENSG00000164334. [A1A519-2]
ENST00000620555; ENSP00000483075; ENSG00000164334. [A1A519-3]
GeneIDi340069.
KEGGihsa:340069.
UCSCiuc003ksm.3. human. [A1A519-1]

Organism-specific databases

CTDi340069.
GeneCardsiFAM170A.
HGNCiHGNC:27963. FAM170A.
HPAiHPA037900.
HPA037901.
HPA037902.
neXtProtiNX_A1A519.
PharmGKBiPA162387167.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGZX. Eukaryota.
ENOG4111C5N. LUCA.
GeneTreeiENSGT00530000063963.
HOGENOMiHOG000050239.
HOVERGENiHBG060499.
InParanoidiA1A519.
OMAiCHVFHLT.
OrthoDBiEOG091G1ATE.
PhylomeDBiA1A519.
TreeFamiTF337124.

Miscellaneous databases

GenomeRNAii340069.
PROiA1A519.

Gene expression databases

BgeeiENSG00000164334.
CleanExiHS_FAM170A.
ExpressionAtlasiA1A519. baseline and differential.
GenevisibleiA1A519. HS.

Family and domain databases

InterProiIPR033376. FAM170A.
[Graphical view]
PANTHERiPTHR33517:SF3. PTHR33517:SF3. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiF170A_HUMAN
AccessioniPrimary (citable) accession number: A1A519
Secondary accession number(s): Q66LM8, Q7Z4V2, Q8IW94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: January 23, 2007
Last modified: September 7, 2016
This is version 85 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.