Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 189

Gene

CCDC189

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 189
Gene namesi
Name:CCDC189
Synonyms:C16orf93
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:28078. CCDC189.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164716879.

Polymorphism and mutation databases

BioMutaiC16orf93.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 331331Coiled-coil domain-containing protein 189PRO_0000321842Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei34 – 341PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiA1A4V9.
PaxDbiA1A4V9.
PRIDEiA1A4V9.

PTM databases

iPTMnetiA1A4V9.
PhosphoSiteiA1A4V9.

Expressioni

Gene expression databases

BgeeiENSG00000196118.
ExpressionAtlasiA1A4V9. baseline and differential.
GenevisibleiA1A4V9. HS.

Organism-specific databases

HPAiHPA041806.
HPA046289.

Interactioni

Protein-protein interaction databases

BioGridi124769. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliA1A4V9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili286 – 31732Sequence analysisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IQKE. Eukaryota.
ENOG4111H80. LUCA.
GeneTreeiENSGT00390000017659.
HOGENOMiHOG000067914.
InParanoidiA1A4V9.
PhylomeDBiA1A4V9.
TreeFamiTF343725.

Family and domain databases

InterProiIPR032727. CLAMP.
[Graphical view]
PfamiPF14769. CLAMP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A1A4V9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLNRKTSHFL GMRVQSELEH LSELRREAGK DRSSVHGSAA RTRASVRTQW
60 70 80 90 100
TTAAAAKADE DPGANLFPPP LPRPRICMWK YLDVHSMHQL EKTTNAEMRE
110 120 130 140 150
VLAELLELGC PEQSLRDAIT LDLFCHALIF CRQQGFSLEQ TSAACALLQD
160 170 180 190 200
LHKACIATPL GNVEECYRYF TSVLFCHGVR RPPFSIDLFK EEQLLALEDY
210 220 230 240 250
VVNTYFRHFK LYKYVFTPQV RLDLSLTYMG LQPPKLWPES ETEKEESKEM
260 270 280 290 300
EEQAVTPQKE ELETVAPPEP EPSHIHVLRA YIKTQVNKEL EQLQGLVEER
310 320 330
LKASEERLSS KLTALERPFQ LPPGKGKSKT K
Length:331
Mass (Da):37,921
Last modified:January 23, 2007 - v1
Checksum:i1E91B401106D6CDC
GO
Isoform 2 (identifier: A1A4V9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MLNRKTSHFL...DEDPGANLFP → MASYSGFSGLLEIRYGPGHRSCLPQFAFFPQ

Note: No experimental confirmation available.
Show »
Length:294
Mass (Da):33,880
Checksum:i032937134F1D6436
GO
Isoform 3 (identifier: A1A4V9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-228: Missing.

Note: No experimental confirmation available.
Show »
Length:103
Mass (Da):11,755
Checksum:iFFED79797497A42B
GO
Isoform 4 (identifier: A1A4V9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     157-176: ATPLGNVEECYRYFTSVLFC → GERGQLPGLSPREKRNRAWH
     177-330: Missing.

Note: No experimental confirmation available.
Show »
Length:177
Mass (Da):19,995
Checksum:iD0D63D4D5581458F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti244 – 2441K → E in AAH92491 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 228228Missing in isoform 3. 1 PublicationVSP_031807Add
BLAST
Alternative sequencei1 – 6868MLNRK…ANLFP → MASYSGFSGLLEIRYGPGHR SCLPQFAFFPQ in isoform 2. 1 PublicationVSP_031808Add
BLAST
Alternative sequencei157 – 17620ATPLG…SVLFC → GERGQLPGLSPREKRNRAWH in isoform 4. 1 PublicationVSP_045828Add
BLAST
Alternative sequencei177 – 330154Missing in isoform 4. 1 PublicationVSP_045829Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC106886 Genomic DNA. No translation available.
CH471192 Genomic DNA. Translation: EAW52202.1.
CH471192 Genomic DNA. Translation: EAW52206.1.
BC073881 mRNA. No translation available.
BC092491 mRNA. Translation: AAH92491.1.
BC128128 mRNA. Translation: AAI28129.1.
BC128129 mRNA. Translation: AAI28130.1.
CCDSiCCDS32434.2. [A1A4V9-1]
CCDS55993.1. [A1A4V9-4]
RefSeqiNP_001014979.2. NM_001014979.2. [A1A4V9-1]
NP_001182549.1. NM_001195620.1. [A1A4V9-4]
UniGeneiHs.724010.

Genome annotation databases

EnsembliENST00000543610; ENSP00000437532; ENSG00000196118. [A1A4V9-1]
ENST00000545825; ENSP00000441164; ENSG00000196118. [A1A4V9-4]
GeneIDi90835.
KEGGihsa:90835.
UCSCiuc002dzm.4. human. [A1A4V9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC106886 Genomic DNA. No translation available.
CH471192 Genomic DNA. Translation: EAW52202.1.
CH471192 Genomic DNA. Translation: EAW52206.1.
BC073881 mRNA. No translation available.
BC092491 mRNA. Translation: AAH92491.1.
BC128128 mRNA. Translation: AAI28129.1.
BC128129 mRNA. Translation: AAI28130.1.
CCDSiCCDS32434.2. [A1A4V9-1]
CCDS55993.1. [A1A4V9-4]
RefSeqiNP_001014979.2. NM_001014979.2. [A1A4V9-1]
NP_001182549.1. NM_001195620.1. [A1A4V9-4]
UniGeneiHs.724010.

3D structure databases

ProteinModelPortaliA1A4V9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124769. 2 interactions.

PTM databases

iPTMnetiA1A4V9.
PhosphoSiteiA1A4V9.

Polymorphism and mutation databases

BioMutaiC16orf93.

Proteomic databases

MaxQBiA1A4V9.
PaxDbiA1A4V9.
PRIDEiA1A4V9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000543610; ENSP00000437532; ENSG00000196118. [A1A4V9-1]
ENST00000545825; ENSP00000441164; ENSG00000196118. [A1A4V9-4]
GeneIDi90835.
KEGGihsa:90835.
UCSCiuc002dzm.4. human. [A1A4V9-1]

Organism-specific databases

CTDi90835.
GeneCardsiC16orf93.
HGNCiHGNC:28078. CCDC189.
HPAiHPA041806.
HPA046289.
neXtProtiNX_A1A4V9.
PharmGKBiPA164716879.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQKE. Eukaryota.
ENOG4111H80. LUCA.
GeneTreeiENSGT00390000017659.
HOGENOMiHOG000067914.
InParanoidiA1A4V9.
PhylomeDBiA1A4V9.
TreeFamiTF343725.

Miscellaneous databases

ChiTaRSiC16orf93. human.
GenomeRNAii90835.
PROiA1A4V9.

Gene expression databases

BgeeiENSG00000196118.
ExpressionAtlasiA1A4V9. baseline and differential.
GenevisibleiA1A4V9. HS.

Family and domain databases

InterProiIPR032727. CLAMP.
[Graphical view]
PfamiPF14769. CLAMP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCC189_HUMAN
AccessioniPrimary (citable) accession number: A1A4V9
Secondary accession number(s): A1A4V8, F5GX13, Q569G2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: January 23, 2007
Last modified: September 7, 2016
This is version 76 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.