Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A1A4F0

- CC055_HUMAN

UniProt

A1A4F0 - CC055_HUMAN

Protein

Putative uncharacterized protein C3orf55

Gene

C3orf55

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
  1. Names & Taxonomyi

    Protein namesi
    Recommended name:
    Putative uncharacterized protein C3orf55
    Gene namesi
    Name:C3orf55
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:25146. C3orf55.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485331.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 135135Putative uncharacterized protein C3orf55PRO_0000301950Add
    BLAST

    Proteomic databases

    PaxDbiA1A4F0.
    PRIDEiA1A4F0.

    PTM databases

    PhosphoSiteiA1A4F0.

    Expressioni

    Gene expression databases

    ArrayExpressiA1A4F0.
    BgeeiA1A4F0.
    CleanExiHS_C3orf55.
    GenevestigatoriA1A4F0.

    Organism-specific databases

    HPAiHPA054395.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000413228.

    Structurei

    3D structure databases

    ProteinModelPortaliA1A4F0.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Phylogenomic databases

    eggNOGiNOG326634.
    HOGENOMiHOG000111368.
    OMAiGREWSEM.
    OrthoDBiEOG73Z2W5.
    PhylomeDBiA1A4F0.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A1A4F0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKVVGNYRVN TANSSTDTSG EHLTCLRSQL FVAYRNGRVD EAVSLGFLDC    50
    WIGGDLTNFK GCYLTNQLPI QIFTAIFDMN TDVIILSQFM YYRLKNQKKK 100
    MIFQPQLFKD SITREKVRLS LWGVLCPVYI PYSFR 135

    Note: No experimental confirmation available.

    Length:135
    Mass (Da):15,626
    Last modified:March 24, 2009 - v2
    Checksum:iE7478D8AA2393875
    GO
    Isoform 2 (identifier: A1A4F0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         101-135: MIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR → ISEEDLRKELHFCCLHWP

    Note: No experimental confirmation available.

    Show »
    Length:118
    Mass (Da):13,650
    Checksum:i86169F853088C320
    GO
    Isoform 3 (identifier: A1A4F0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         72-135: IFTAIFDMNTDVIILSQFMYYRLKNQKKKMIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR → F

    Note: No experimental confirmation available.

    Show »
    Length:72
    Mass (Da):8,007
    Checksum:i383B276047789946
    GO
    Isoform 4 (identifier: A1A4F0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         72-135: IFTAIFDMNT...CPVYIPYSFR → DIPTSVIQRL...NTSKRRFILT

    Note: No experimental confirmation available.

    Show »
    Length:133
    Mass (Da):14,994
    Checksum:i79F7AF00C9C679B9
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti4 – 41V → L.
    Corresponds to variant rs7616293 [ dbSNP | Ensembl ].
    VAR_050723

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei72 – 13564IFTAI…PYSFR → F in isoform 3. 1 PublicationVSP_045571Add
    BLAST
    Alternative sequencei72 – 13564IFTAI…PYSFR → DIPTSVIQRLHHQRESQIVT LGSPLPCIYPIFFQISEISM PGYYSCLCHTTINTSKRRFI LT in isoform 4. 1 PublicationVSP_046204Add
    BLAST
    Alternative sequencei101 – 13535MIFQP…PYSFR → ISEEDLRKELHFCCLHWP in isoform 2. 1 PublicationVSP_036612Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC084212 Genomic DNA. No translation available.
    CH471052 Genomic DNA. Translation: EAW78701.1.
    BC010062 mRNA. No translation available.
    BC029129 mRNA. Translation: AAH29129.1. Sequence problems.
    BC126187 mRNA. Translation: AAI26188.1.
    BC126189 mRNA. Translation: AAI26190.1.
    BC144066 mRNA. No translation available.
    CCDSiCCDS46942.1. [A1A4F0-4]
    CCDS46943.1. [A1A4F0-1]
    CCDS46944.1. [A1A4F0-2]
    CCDS58859.1. [A1A4F0-3]
    RefSeqiNP_001093247.1. NM_001099777.3. [A1A4F0-2]
    NP_001123473.1. NM_001130001.2. [A1A4F0-4]
    NP_001123474.1. NM_001130002.2. [A1A4F0-1]
    NP_001230658.1. NM_001243729.1. [A1A4F0-3]
    UniGeneiHs.259046.

    Genome annotation databases

    EnsembliENST00000312275; ENSP00000312323; ENSG00000174899. [A1A4F0-2]
    ENST00000426338; ENSP00000387918; ENSG00000174899. [A1A4F0-4]
    ENST00000449199; ENSP00000413228; ENSG00000174899. [A1A4F0-1]
    ENST00000459838; ENSP00000420317; ENSG00000174899. [A1A4F0-3]
    GeneIDi152078.
    KEGGihsa:152078.
    UCSCiuc003fbo.3. human. [A1A4F0-2]
    uc003fbp.4. human. [A1A4F0-1]
    uc010hvv.3. human.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC084212 Genomic DNA. No translation available.
    CH471052 Genomic DNA. Translation: EAW78701.1 .
    BC010062 mRNA. No translation available.
    BC029129 mRNA. Translation: AAH29129.1 . Sequence problems.
    BC126187 mRNA. Translation: AAI26188.1 .
    BC126189 mRNA. Translation: AAI26190.1 .
    BC144066 mRNA. No translation available.
    CCDSi CCDS46942.1. [A1A4F0-4 ]
    CCDS46943.1. [A1A4F0-1 ]
    CCDS46944.1. [A1A4F0-2 ]
    CCDS58859.1. [A1A4F0-3 ]
    RefSeqi NP_001093247.1. NM_001099777.3. [A1A4F0-2 ]
    NP_001123473.1. NM_001130001.2. [A1A4F0-4 ]
    NP_001123474.1. NM_001130002.2. [A1A4F0-1 ]
    NP_001230658.1. NM_001243729.1. [A1A4F0-3 ]
    UniGenei Hs.259046.

    3D structure databases

    ProteinModelPortali A1A4F0.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000413228.

    PTM databases

    PhosphoSitei A1A4F0.

    Proteomic databases

    PaxDbi A1A4F0.
    PRIDEi A1A4F0.

    Protocols and materials databases

    DNASUi 152078.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000312275 ; ENSP00000312323 ; ENSG00000174899 . [A1A4F0-2 ]
    ENST00000426338 ; ENSP00000387918 ; ENSG00000174899 . [A1A4F0-4 ]
    ENST00000449199 ; ENSP00000413228 ; ENSG00000174899 . [A1A4F0-1 ]
    ENST00000459838 ; ENSP00000420317 ; ENSG00000174899 . [A1A4F0-3 ]
    GeneIDi 152078.
    KEGGi hsa:152078.
    UCSCi uc003fbo.3. human. [A1A4F0-2 ]
    uc003fbp.4. human. [A1A4F0-1 ]
    uc010hvv.3. human.

    Organism-specific databases

    CTDi 152078.
    GeneCardsi GC03P157261.
    HGNCi HGNC:25146. C3orf55.
    HPAi HPA054395.
    neXtProti NX_A1A4F0.
    PharmGKBi PA143485331.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG326634.
    HOGENOMi HOG000111368.
    OMAi GREWSEM.
    OrthoDBi EOG73Z2W5.
    PhylomeDBi A1A4F0.

    Miscellaneous databases

    GenomeRNAii 152078.
    NextBioi 86869.

    Gene expression databases

    ArrayExpressi A1A4F0.
    Bgeei A1A4F0.
    CleanExi HS_C3orf55.
    Genevestigatori A1A4F0.

    Family and domain databases

    ProtoNeti Search...

    Publicationsi

    1. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
      Tissue: Brain and Melanoma.

    Entry informationi

    Entry nameiCC055_HUMAN
    AccessioniPrimary (citable) accession number: A1A4F0
    Secondary accession number(s): C9JP04, C9JXB5, Q8N6Q6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 11, 2007
    Last sequence update: March 24, 2009
    Last modified: October 1, 2014
    This is version 57 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations

    External Data

    Dasty 3