Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative uncharacterized protein PQLC2L

Gene

PQLC2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Putative uncharacterized protein PQLC2LCurated
Alternative name(s):
PQ-loop repeat-containing protein 2-likeImported
Gene namesi
Name:PQLC2LImported
Synonyms:C3orf55Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:25146. PQLC2L.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi152078.
OpenTargetsiENSG00000174899.
PharmGKBiPA143485331.

Polymorphism and mutation databases

BioMutaiC3orf55.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003019501 – 135Putative uncharacterized protein PQLC2LAdd BLAST135

Proteomic databases

PaxDbiA1A4F0.
PRIDEiA1A4F0.

Expressioni

Gene expression databases

BgeeiENSG00000174899.
CleanExiHS_C3orf55.
ExpressionAtlasiA1A4F0. baseline and differential.
GenevisibleiA1A4F0. HS.

Organism-specific databases

HPAiHPA054395.

Interactioni

Protein-protein interaction databases

IntActiA1A4F0. 1 interactor.
STRINGi9606.ENSP00000413228.

Structurei

3D structure databases

ProteinModelPortaliA1A4F0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiKOG2913. Eukaryota.
ENOG4111FM2. LUCA.
GeneTreeiENSGT00390000003344.
HOGENOMiHOG000111368.
InParanoidiA1A4F0.
OMAiREHLTCL.
OrthoDBiEOG091G0SAK.
PhylomeDBiA1A4F0.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A1A4F0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKVVGNYRVN TANSSTDTSG EHLTCLRSQL FVAYRNGRVD EAVSLGFLDC
60 70 80 90 100
WIGGDLTNFK GCYLTNQLPI QIFTAIFDMN TDVIILSQFM YYRLKNQKKK
110 120 130
MIFQPQLFKD SITREKVRLS LWGVLCPVYI PYSFR
Note: No experimental confirmation available.
Length:135
Mass (Da):15,626
Last modified:March 24, 2009 - v2
Checksum:iE7478D8AA2393875
GO
Isoform 2 (identifier: A1A4F0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-135: MIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR → ISEEDLRKELHFCCLHWP

Note: No experimental confirmation available.
Show »
Length:118
Mass (Da):13,650
Checksum:i86169F853088C320
GO
Isoform 3 (identifier: A1A4F0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-135: IFTAIFDMNTDVIILSQFMYYRLKNQKKKMIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR → F

Note: No experimental confirmation available.
Show »
Length:72
Mass (Da):8,007
Checksum:i383B276047789946
GO
Isoform 4 (identifier: A1A4F0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-135: IFTAIFDMNT...CPVYIPYSFR → DIPTSVIQRL...NTSKRRFILT

Note: No experimental confirmation available.
Show »
Length:133
Mass (Da):14,994
Checksum:i79F7AF00C9C679B9
GO

Sequence cautioni

The sequence AAH29129 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0507234V → L.Corresponds to variant rs7616293dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04557172 – 135IFTAI…PYSFR → F in isoform 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_04620472 – 135IFTAI…PYSFR → DIPTSVIQRLHHQRESQIVT LGSPLPCIYPIFFQISEISM PGYYSCLCHTTINTSKRRFI LT in isoform 4. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_036612101 – 135MIFQP…PYSFR → ISEEDLRKELHFCCLHWP in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC084212 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78701.1.
BC010062 mRNA. No translation available.
BC029129 mRNA. Translation: AAH29129.1. Sequence problems.
BC126187 mRNA. Translation: AAI26188.1.
BC126189 mRNA. Translation: AAI26190.1.
BC144066 mRNA. No translation available.
CCDSiCCDS46942.1. [A1A4F0-4]
CCDS46943.1. [A1A4F0-1]
CCDS46944.1. [A1A4F0-2]
CCDS58859.1. [A1A4F0-3]
RefSeqiNP_001093247.1. NM_001099777.3. [A1A4F0-2]
NP_001123473.1. NM_001130001.2. [A1A4F0-4]
NP_001123474.1. NM_001130002.2. [A1A4F0-1]
NP_001230658.1. NM_001243729.1. [A1A4F0-3]
UniGeneiHs.259046.

Genome annotation databases

EnsembliENST00000312275; ENSP00000312323; ENSG00000174899. [A1A4F0-2]
ENST00000426338; ENSP00000387918; ENSG00000174899. [A1A4F0-4]
ENST00000449199; ENSP00000413228; ENSG00000174899. [A1A4F0-1]
ENST00000459838; ENSP00000420317; ENSG00000174899. [A1A4F0-3]
GeneIDi152078.
KEGGihsa:152078.
UCSCiuc003fbo.4. human. [A1A4F0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC084212 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78701.1.
BC010062 mRNA. No translation available.
BC029129 mRNA. Translation: AAH29129.1. Sequence problems.
BC126187 mRNA. Translation: AAI26188.1.
BC126189 mRNA. Translation: AAI26190.1.
BC144066 mRNA. No translation available.
CCDSiCCDS46942.1. [A1A4F0-4]
CCDS46943.1. [A1A4F0-1]
CCDS46944.1. [A1A4F0-2]
CCDS58859.1. [A1A4F0-3]
RefSeqiNP_001093247.1. NM_001099777.3. [A1A4F0-2]
NP_001123473.1. NM_001130001.2. [A1A4F0-4]
NP_001123474.1. NM_001130002.2. [A1A4F0-1]
NP_001230658.1. NM_001243729.1. [A1A4F0-3]
UniGeneiHs.259046.

3D structure databases

ProteinModelPortaliA1A4F0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiA1A4F0. 1 interactor.
STRINGi9606.ENSP00000413228.

Polymorphism and mutation databases

BioMutaiC3orf55.

Proteomic databases

PaxDbiA1A4F0.
PRIDEiA1A4F0.

Protocols and materials databases

DNASUi152078.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000312275; ENSP00000312323; ENSG00000174899. [A1A4F0-2]
ENST00000426338; ENSP00000387918; ENSG00000174899. [A1A4F0-4]
ENST00000449199; ENSP00000413228; ENSG00000174899. [A1A4F0-1]
ENST00000459838; ENSP00000420317; ENSG00000174899. [A1A4F0-3]
GeneIDi152078.
KEGGihsa:152078.
UCSCiuc003fbo.4. human. [A1A4F0-1]

Organism-specific databases

CTDi152078.
DisGeNETi152078.
GeneCardsiPQLC2L.
HGNCiHGNC:25146. PQLC2L.
HPAiHPA054395.
neXtProtiNX_A1A4F0.
OpenTargetsiENSG00000174899.
PharmGKBiPA143485331.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2913. Eukaryota.
ENOG4111FM2. LUCA.
GeneTreeiENSGT00390000003344.
HOGENOMiHOG000111368.
InParanoidiA1A4F0.
OMAiREHLTCL.
OrthoDBiEOG091G0SAK.
PhylomeDBiA1A4F0.

Miscellaneous databases

ChiTaRSiC3orf55. human.
GenomeRNAii152078.
PROiA1A4F0.

Gene expression databases

BgeeiENSG00000174899.
CleanExiHS_C3orf55.
ExpressionAtlasiA1A4F0. baseline and differential.
GenevisibleiA1A4F0. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiCC055_HUMAN
AccessioniPrimary (citable) accession number: A1A4F0
Secondary accession number(s): C9JP04, C9JXB5, Q8N6Q6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: March 24, 2009
Last modified: November 30, 2016
This is version 72 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.