Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative uncharacterized protein PQLC2L

Gene

PQLC2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Putative uncharacterized protein PQLC2LCurated
Alternative name(s):
PQ-loop repeat-containing protein 2-likeImported
Gene namesi
Name:PQLC2LImported
Synonyms:C3orf55Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:25146. PQLC2L.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485331.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 135135Putative uncharacterized protein PQLC2LPRO_0000301950Add
BLAST

Proteomic databases

PaxDbiA1A4F0.
PRIDEiA1A4F0.

PTM databases

PhosphoSiteiA1A4F0.

Expressioni

Gene expression databases

BgeeiA1A4F0.
CleanExiHS_C3orf55.
ExpressionAtlasiA1A4F0. baseline and differential.
GenevestigatoriA1A4F0.

Organism-specific databases

HPAiHPA054395.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000413228.

Structurei

3D structure databases

ProteinModelPortaliA1A4F0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiNOG326634.
GeneTreeiENSGT00390000003344.
HOGENOMiHOG000111368.
InParanoidiA1A4F0.
OMAiMNTDIII.
OrthoDBiEOG73Z2W5.
PhylomeDBiA1A4F0.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A1A4F0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKVVGNYRVN TANSSTDTSG EHLTCLRSQL FVAYRNGRVD EAVSLGFLDC
60 70 80 90 100
WIGGDLTNFK GCYLTNQLPI QIFTAIFDMN TDVIILSQFM YYRLKNQKKK
110 120 130
MIFQPQLFKD SITREKVRLS LWGVLCPVYI PYSFR

Note: No experimental confirmation available.

Length:135
Mass (Da):15,626
Last modified:March 24, 2009 - v2
Checksum:iE7478D8AA2393875
GO
Isoform 2 (identifier: A1A4F0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-135: MIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR → ISEEDLRKELHFCCLHWP

Note: No experimental confirmation available.

Show »
Length:118
Mass (Da):13,650
Checksum:i86169F853088C320
GO
Isoform 3 (identifier: A1A4F0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-135: IFTAIFDMNTDVIILSQFMYYRLKNQKKKMIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR → F

Note: No experimental confirmation available.

Show »
Length:72
Mass (Da):8,007
Checksum:i383B276047789946
GO
Isoform 4 (identifier: A1A4F0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-135: IFTAIFDMNT...CPVYIPYSFR → DIPTSVIQRL...NTSKRRFILT

Note: No experimental confirmation available.

Show »
Length:133
Mass (Da):14,994
Checksum:i79F7AF00C9C679B9
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti4 – 41V → L.
Corresponds to variant rs7616293 [ dbSNP | Ensembl ].
VAR_050723

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei72 – 13564IFTAI…PYSFR → F in isoform 3. 1 PublicationVSP_045571Add
BLAST
Alternative sequencei72 – 13564IFTAI…PYSFR → DIPTSVIQRLHHQRESQIVT LGSPLPCIYPIFFQISEISM PGYYSCLCHTTINTSKRRFI LT in isoform 4. 1 PublicationVSP_046204Add
BLAST
Alternative sequencei101 – 13535MIFQP…PYSFR → ISEEDLRKELHFCCLHWP in isoform 2. 1 PublicationVSP_036612Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC084212 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78701.1.
BC010062 mRNA. No translation available.
BC029129 mRNA. Translation: AAH29129.1. Sequence problems.
BC126187 mRNA. Translation: AAI26188.1.
BC126189 mRNA. Translation: AAI26190.1.
BC144066 mRNA. No translation available.
CCDSiCCDS46942.1. [A1A4F0-4]
CCDS46943.1. [A1A4F0-1]
CCDS46944.1. [A1A4F0-2]
CCDS58859.1. [A1A4F0-3]
RefSeqiNP_001093247.1. NM_001099777.3. [A1A4F0-2]
NP_001123473.1. NM_001130001.2. [A1A4F0-4]
NP_001123474.1. NM_001130002.2. [A1A4F0-1]
NP_001230658.1. NM_001243729.1. [A1A4F0-3]
UniGeneiHs.259046.

Genome annotation databases

EnsembliENST00000312275; ENSP00000312323; ENSG00000174899. [A1A4F0-2]
ENST00000426338; ENSP00000387918; ENSG00000174899. [A1A4F0-4]
ENST00000449199; ENSP00000413228; ENSG00000174899. [A1A4F0-1]
ENST00000459838; ENSP00000420317; ENSG00000174899. [A1A4F0-3]
GeneIDi152078.
KEGGihsa:152078.
UCSCiuc003fbo.3. human. [A1A4F0-2]
uc003fbp.4. human. [A1A4F0-1]
uc010hvv.3. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC084212 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78701.1.
BC010062 mRNA. No translation available.
BC029129 mRNA. Translation: AAH29129.1. Sequence problems.
BC126187 mRNA. Translation: AAI26188.1.
BC126189 mRNA. Translation: AAI26190.1.
BC144066 mRNA. No translation available.
CCDSiCCDS46942.1. [A1A4F0-4]
CCDS46943.1. [A1A4F0-1]
CCDS46944.1. [A1A4F0-2]
CCDS58859.1. [A1A4F0-3]
RefSeqiNP_001093247.1. NM_001099777.3. [A1A4F0-2]
NP_001123473.1. NM_001130001.2. [A1A4F0-4]
NP_001123474.1. NM_001130002.2. [A1A4F0-1]
NP_001230658.1. NM_001243729.1. [A1A4F0-3]
UniGeneiHs.259046.

3D structure databases

ProteinModelPortaliA1A4F0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000413228.

PTM databases

PhosphoSiteiA1A4F0.

Proteomic databases

PaxDbiA1A4F0.
PRIDEiA1A4F0.

Protocols and materials databases

DNASUi152078.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000312275; ENSP00000312323; ENSG00000174899. [A1A4F0-2]
ENST00000426338; ENSP00000387918; ENSG00000174899. [A1A4F0-4]
ENST00000449199; ENSP00000413228; ENSG00000174899. [A1A4F0-1]
ENST00000459838; ENSP00000420317; ENSG00000174899. [A1A4F0-3]
GeneIDi152078.
KEGGihsa:152078.
UCSCiuc003fbo.3. human. [A1A4F0-2]
uc003fbp.4. human. [A1A4F0-1]
uc010hvv.3. human.

Organism-specific databases

CTDi152078.
GeneCardsiGC03P157261.
HGNCiHGNC:25146. PQLC2L.
HPAiHPA054395.
neXtProtiNX_A1A4F0.
PharmGKBiPA143485331.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG326634.
GeneTreeiENSGT00390000003344.
HOGENOMiHOG000111368.
InParanoidiA1A4F0.
OMAiMNTDIII.
OrthoDBiEOG73Z2W5.
PhylomeDBiA1A4F0.

Miscellaneous databases

ChiTaRSiC3orf55. human.
GenomeRNAii152078.
NextBioi86869.

Gene expression databases

BgeeiA1A4F0.
CleanExiHS_C3orf55.
ExpressionAtlasiA1A4F0. baseline and differential.
GenevestigatoriA1A4F0.

Family and domain databases

ProtoNetiSearch...

Publicationsi

  1. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Tissue: Brain and Melanoma.

Entry informationi

Entry nameiCC055_HUMAN
AccessioniPrimary (citable) accession number: A1A4F0
Secondary accession number(s): C9JP04, C9JXB5, Q8N6Q6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: March 24, 2009
Last modified: January 7, 2015
This is version 60 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.