Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A1A4F0 (CC055_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 56. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Putative uncharacterized protein C3orf55
Gene names
Name:C3orf55
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length135 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence caution

The sequence AAH29129.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A1A4F0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: A1A4F0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     101-135: MIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR → ISEEDLRKELHFCCLHWP
Note: No experimental confirmation available.
Isoform 3 (identifier: A1A4F0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     72-135: IFTAIFDMNTDVIILSQFMYYRLKNQKKKMIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR → F
Note: No experimental confirmation available.
Isoform 4 (identifier: A1A4F0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     72-135: IFTAIFDMNT...CPVYIPYSFR → DIPTSVIQRL...NTSKRRFILT
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 135135Putative uncharacterized protein C3orf55
PRO_0000301950

Natural variations

Alternative sequence72 – 13564IFTAI…PYSFR → F in isoform 3.
VSP_045571
Alternative sequence72 – 13564IFTAI…PYSFR → DIPTSVIQRLHHQRESQIVT LGSPLPCIYPIFFQISEISM PGYYSCLCHTTINTSKRRFI LT in isoform 4.
VSP_046204
Alternative sequence101 – 13535MIFQP…PYSFR → ISEEDLRKELHFCCLHWP in isoform 2.
VSP_036612
Natural variant41V → L.
Corresponds to variant rs7616293 [ dbSNP | Ensembl ].
VAR_050723

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 24, 2009. Version 2.
Checksum: E7478D8AA2393875

FASTA13515,626
        10         20         30         40         50         60 
MKVVGNYRVN TANSSTDTSG EHLTCLRSQL FVAYRNGRVD EAVSLGFLDC WIGGDLTNFK 

        70         80         90        100        110        120 
GCYLTNQLPI QIFTAIFDMN TDVIILSQFM YYRLKNQKKK MIFQPQLFKD SITREKVRLS 

       130 
LWGVLCPVYI PYSFR 

« Hide

Isoform 2 [UniParc].

Checksum: 86169F853088C320
Show »

FASTA11813,650
Isoform 3 [UniParc].

Checksum: 383B276047789946
Show »

FASTA728,007
Isoform 4 [UniParc].

Checksum: 79F7AF00C9C679B9
Show »

FASTA13314,994

References

[1]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
Tissue: Brain and Melanoma.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC084212 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78701.1.
BC010062 mRNA. No translation available.
BC029129 mRNA. Translation: AAH29129.1. Sequence problems.
BC126187 mRNA. Translation: AAI26188.1.
BC126189 mRNA. Translation: AAI26190.1.
BC144066 mRNA. No translation available.
CCDSCCDS46942.1. [A1A4F0-4]
CCDS46943.1. [A1A4F0-1]
CCDS46944.1. [A1A4F0-2]
CCDS58859.1. [A1A4F0-3]
RefSeqNP_001093247.1. NM_001099777.3. [A1A4F0-2]
NP_001123473.1. NM_001130001.2. [A1A4F0-4]
NP_001123474.1. NM_001130002.2. [A1A4F0-1]
NP_001230658.1. NM_001243729.1. [A1A4F0-3]
UniGeneHs.259046.

3D structure databases

ProteinModelPortalA1A4F0.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000413228.

PTM databases

PhosphoSiteA1A4F0.

Proteomic databases

PaxDbA1A4F0.
PRIDEA1A4F0.

Protocols and materials databases

DNASU152078.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000312275; ENSP00000312323; ENSG00000174899. [A1A4F0-2]
ENST00000426338; ENSP00000387918; ENSG00000174899. [A1A4F0-4]
ENST00000449199; ENSP00000413228; ENSG00000174899. [A1A4F0-1]
ENST00000459838; ENSP00000420317; ENSG00000174899. [A1A4F0-3]
GeneID152078.
KEGGhsa:152078.
UCSCuc003fbo.3. human. [A1A4F0-2]
uc003fbp.4. human. [A1A4F0-1]
uc010hvv.3. human.

Organism-specific databases

CTD152078.
GeneCardsGC03P157261.
HGNCHGNC:25146. C3orf55.
HPAHPA054395.
neXtProtNX_A1A4F0.
PharmGKBPA143485331.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG326634.
HOGENOMHOG000111368.
OMAGREWSEM.
OrthoDBEOG73Z2W5.
PhylomeDBA1A4F0.

Gene expression databases

ArrayExpressA1A4F0.
BgeeA1A4F0.
CleanExHS_C3orf55.
GenevestigatorA1A4F0.

Family and domain databases

ProtoNetSearch...

Other

GenomeRNAi152078.
NextBio86869.

Entry information

Entry nameCC055_HUMAN
AccessionPrimary (citable) accession number: A1A4F0
Secondary accession number(s): C9JP04, C9JXB5, Q8N6Q6
Entry history
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: March 24, 2009
Last modified: July 9, 2014
This is version 56 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM