Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A1A4F0

- CC055_HUMAN

UniProt

A1A4F0 - CC055_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Putative uncharacterized protein C3orf55

Gene

C3orf55

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Putative uncharacterized protein C3orf55
Gene namesi
Name:C3orf55
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:25146. C3orf55.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485331.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 135135Putative uncharacterized protein C3orf55PRO_0000301950Add
BLAST

Proteomic databases

PaxDbiA1A4F0.
PRIDEiA1A4F0.

PTM databases

PhosphoSiteiA1A4F0.

Expressioni

Gene expression databases

BgeeiA1A4F0.
CleanExiHS_C3orf55.
ExpressionAtlasiA1A4F0. baseline and differential.
GenevestigatoriA1A4F0.

Organism-specific databases

HPAiHPA054395.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000413228.

Structurei

3D structure databases

ProteinModelPortaliA1A4F0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiNOG326634.
GeneTreeiENSGT00390000003344.
HOGENOMiHOG000111368.
InParanoidiA1A4F0.
OMAiGREWSEM.
OrthoDBiEOG73Z2W5.
PhylomeDBiA1A4F0.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A1A4F0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKVVGNYRVN TANSSTDTSG EHLTCLRSQL FVAYRNGRVD EAVSLGFLDC
60 70 80 90 100
WIGGDLTNFK GCYLTNQLPI QIFTAIFDMN TDVIILSQFM YYRLKNQKKK
110 120 130
MIFQPQLFKD SITREKVRLS LWGVLCPVYI PYSFR

Note: No experimental confirmation available.

Length:135
Mass (Da):15,626
Last modified:March 24, 2009 - v2
Checksum:iE7478D8AA2393875
GO
Isoform 2 (identifier: A1A4F0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-135: MIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR → ISEEDLRKELHFCCLHWP

Note: No experimental confirmation available.

Show »
Length:118
Mass (Da):13,650
Checksum:i86169F853088C320
GO
Isoform 3 (identifier: A1A4F0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-135: IFTAIFDMNTDVIILSQFMYYRLKNQKKKMIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR → F

Note: No experimental confirmation available.

Show »
Length:72
Mass (Da):8,007
Checksum:i383B276047789946
GO
Isoform 4 (identifier: A1A4F0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-135: IFTAIFDMNT...CPVYIPYSFR → DIPTSVIQRL...NTSKRRFILT

Note: No experimental confirmation available.

Show »
Length:133
Mass (Da):14,994
Checksum:i79F7AF00C9C679B9
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti4 – 41V → L.
Corresponds to variant rs7616293 [ dbSNP | Ensembl ].
VAR_050723

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei72 – 13564IFTAI…PYSFR → F in isoform 3. 1 PublicationVSP_045571Add
BLAST
Alternative sequencei72 – 13564IFTAI…PYSFR → DIPTSVIQRLHHQRESQIVT LGSPLPCIYPIFFQISEISM PGYYSCLCHTTINTSKRRFI LT in isoform 4. 1 PublicationVSP_046204Add
BLAST
Alternative sequencei101 – 13535MIFQP…PYSFR → ISEEDLRKELHFCCLHWP in isoform 2. 1 PublicationVSP_036612Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC084212 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78701.1.
BC010062 mRNA. No translation available.
BC029129 mRNA. Translation: AAH29129.1. Sequence problems.
BC126187 mRNA. Translation: AAI26188.1.
BC126189 mRNA. Translation: AAI26190.1.
BC144066 mRNA. No translation available.
CCDSiCCDS46942.1. [A1A4F0-4]
CCDS46943.1. [A1A4F0-1]
CCDS46944.1. [A1A4F0-2]
CCDS58859.1. [A1A4F0-3]
RefSeqiNP_001093247.1. NM_001099777.3. [A1A4F0-2]
NP_001123473.1. NM_001130001.2. [A1A4F0-4]
NP_001123474.1. NM_001130002.2. [A1A4F0-1]
NP_001230658.1. NM_001243729.1. [A1A4F0-3]
UniGeneiHs.259046.

Genome annotation databases

EnsembliENST00000312275; ENSP00000312323; ENSG00000174899. [A1A4F0-2]
ENST00000426338; ENSP00000387918; ENSG00000174899. [A1A4F0-4]
ENST00000449199; ENSP00000413228; ENSG00000174899. [A1A4F0-1]
ENST00000459838; ENSP00000420317; ENSG00000174899. [A1A4F0-3]
GeneIDi152078.
KEGGihsa:152078.
UCSCiuc003fbo.3. human. [A1A4F0-2]
uc003fbp.4. human. [A1A4F0-1]
uc010hvv.3. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC084212 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78701.1 .
BC010062 mRNA. No translation available.
BC029129 mRNA. Translation: AAH29129.1 . Sequence problems.
BC126187 mRNA. Translation: AAI26188.1 .
BC126189 mRNA. Translation: AAI26190.1 .
BC144066 mRNA. No translation available.
CCDSi CCDS46942.1. [A1A4F0-4 ]
CCDS46943.1. [A1A4F0-1 ]
CCDS46944.1. [A1A4F0-2 ]
CCDS58859.1. [A1A4F0-3 ]
RefSeqi NP_001093247.1. NM_001099777.3. [A1A4F0-2 ]
NP_001123473.1. NM_001130001.2. [A1A4F0-4 ]
NP_001123474.1. NM_001130002.2. [A1A4F0-1 ]
NP_001230658.1. NM_001243729.1. [A1A4F0-3 ]
UniGenei Hs.259046.

3D structure databases

ProteinModelPortali A1A4F0.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000413228.

PTM databases

PhosphoSitei A1A4F0.

Proteomic databases

PaxDbi A1A4F0.
PRIDEi A1A4F0.

Protocols and materials databases

DNASUi 152078.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000312275 ; ENSP00000312323 ; ENSG00000174899 . [A1A4F0-2 ]
ENST00000426338 ; ENSP00000387918 ; ENSG00000174899 . [A1A4F0-4 ]
ENST00000449199 ; ENSP00000413228 ; ENSG00000174899 . [A1A4F0-1 ]
ENST00000459838 ; ENSP00000420317 ; ENSG00000174899 . [A1A4F0-3 ]
GeneIDi 152078.
KEGGi hsa:152078.
UCSCi uc003fbo.3. human. [A1A4F0-2 ]
uc003fbp.4. human. [A1A4F0-1 ]
uc010hvv.3. human.

Organism-specific databases

CTDi 152078.
GeneCardsi GC03P157261.
HGNCi HGNC:25146. C3orf55.
HPAi HPA054395.
neXtProti NX_A1A4F0.
PharmGKBi PA143485331.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG326634.
GeneTreei ENSGT00390000003344.
HOGENOMi HOG000111368.
InParanoidi A1A4F0.
OMAi GREWSEM.
OrthoDBi EOG73Z2W5.
PhylomeDBi A1A4F0.

Miscellaneous databases

ChiTaRSi C3orf55. human.
GenomeRNAii 152078.
NextBioi 86869.

Gene expression databases

Bgeei A1A4F0.
CleanExi HS_C3orf55.
ExpressionAtlasi A1A4F0. baseline and differential.
Genevestigatori A1A4F0.

Family and domain databases

ProtoNeti Search...

Publicationsi

  1. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Tissue: Brain and Melanoma.

Entry informationi

Entry nameiCC055_HUMAN
AccessioniPrimary (citable) accession number: A1A4F0
Secondary accession number(s): C9JP04, C9JXB5, Q8N6Q6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: March 24, 2009
Last modified: November 26, 2014
This is version 59 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

External Data

Dasty 3