Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A0PJK1

- SC5AA_HUMAN

UniProt

A0PJK1 - SC5AA_HUMAN

Protein

Sodium/glucose cotransporter 5

Gene

SLC5A10

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 76 (01 Oct 2014)
      Sequence version 2 (13 Nov 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    High capacity transporter for mannose and fructose and, to a lesser extent, glucose, AMG, and galactose.1 Publication

    GO - Molecular functioni

    1. transporter activity Source: InterPro

    GO - Biological processi

    1. sodium ion transport Source: UniProtKB-KW
    2. transmembrane transport Source: InterPro

    Keywords - Biological processi

    Ion transport, Sodium transport, Transport

    Keywords - Ligandi

    Sodium

    Protein family/group databases

    TCDBi2.A.21.3.15. the solute:sodium symporter (sss) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sodium/glucose cotransporter 5
    Short name:
    Na(+)/glucose cotransporter 5
    Alternative name(s):
    Solute carrier family 5 member 10
    Gene namesi
    Name:SLC5A10
    Synonyms:SGLT5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:23155. SLC5A10.

    Subcellular locationi

    Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. integral component of membrane Source: UniProtKB-KW
    3. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134940254.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 596596Sodium/glucose cotransporter 5PRO_0000311211Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi4 – 41N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi96 – 961N-linked (GlcNAc...)Sequence Analysis
    Modified residuei141 – 1411Phosphoserine1 Publication
    Modified residuei145 – 1451Phosphoserine1 Publication
    Modified residuei148 – 1481Phosphothreonine1 Publication

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiA0PJK1.
    PRIDEiA0PJK1.

    PTM databases

    PhosphoSiteiA0PJK1.

    Expressioni

    Tissue specificityi

    Seems to be exclusively expressed in kidney.1 Publication

    Gene expression databases

    BgeeiA0PJK1.
    CleanExiHS_SLC5A10.
    GenevestigatoriA0PJK1.

    Organism-specific databases

    HPAiHPA052014.

    Interactioni

    Protein-protein interaction databases

    MINTiMINT-4722994.
    STRINGi9606.ENSP00000379008.

    Structurei

    3D structure databases

    ProteinModelPortaliA0PJK1.
    SMRiA0PJK1. Positions 17-480.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1515ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini37 – 7236CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini94 – 996ExtracellularSequence Analysis
    Topological domaini121 – 14929CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini171 – 1733ExtracellularSequence Analysis
    Topological domaini195 – 2006CytoplasmicSequence Analysis
    Topological domaini222 – 26443ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini286 – 30015CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini322 – 35534ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini377 – 40933CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini431 – 44313ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini465 – 4717CytoplasmicSequence Analysis
    Topological domaini493 – 51321ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini535 – 57541CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei16 – 3621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei73 – 9321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei100 – 12021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei150 – 17021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei174 – 19421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei201 – 22121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei265 – 28521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei301 – 32121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei356 – 37621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei410 – 43021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei444 – 46421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei472 – 49221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei514 – 53421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei576 – 59621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG4146.
    HOGENOMiHOG000025422.
    HOVERGENiHBG052859.
    KOiK14390.
    OMAiHNERRIK.
    OrthoDBiEOG77126J.
    PhylomeDBiA0PJK1.
    TreeFamiTF352855.

    Family and domain databases

    InterProiIPR001734. Na/solute_symporter.
    IPR018212. Na/solute_symporter_CS.
    IPR019900. Na/solute_symporter_subgr.
    [Graphical view]
    PANTHERiPTHR11819. PTHR11819. 1 hit.
    PfamiPF00474. SSF. 1 hit.
    [Graphical view]
    TIGRFAMsiTIGR00813. sss. 1 hit.
    PROSITEiPS00457. NA_SOLUT_SYMP_2. 1 hit.
    PS50283. NA_SOLUT_SYMP_3. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A0PJK1-1) [UniParc]FASTAAdd to Basket

    Also known as: IF2

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAANSTSDLH TPGTQLSVAD IIVITVYFAL NVAVGIWSSC RASRNTVNGY    50
    FLAGRDMTWW PIGASLFASS EGSGLFIGLA GSGAAGGLAV AGFEWNATYV 100
    LLALAWVFVP IYISSEIVTL PEYIQKRYGG QRIRMYLSVL SLLLSVFTKI 150
    SLDLYAGALF VHICLGWNFY LSTILTLGIT ALYTIAGGLA AVIYTDALQT 200
    LIMVVGAVIL TIKAFDQIGG YGQLEAAYAQ AIPSRTIANT TCHLPRTDAM 250
    HMFRDPHTGD LPWTGMTFGL TIMATWYWCT DQVIVQRSLS ARDLNHAKAG 300
    SILASYLKML PMGLIIMPGM ISRALFPDDV GCVVPSECLR ACGAEVGCSN 350
    IAYPKLVMEL MPIGLRGLMI AVMLAALMSS LTSIFNSSST LFTMDIWRRL 400
    RPRSGERELL LVGRLVIVAL IGVSVAWIPV LQDSNSGQLF IYMQSVTSSL 450
    APPVTAVFVL GVFWRRANEQ GAFWGLIAGL VVGATRLVLE FLNPAPPCGE 500
    PDTRPAVLGS IHYLHFAVAL FALSGAVVVA GSLLTPPPQS VQIENLTWWT 550
    LAQDVPLGTK AGDGQTPQKH AFWARVCGFN AILLMCVNIF FYAYFA 596
    Length:596
    Mass (Da):64,342
    Last modified:November 13, 2007 - v2
    Checksum:i73D104A9F8065926
    GO
    Isoform 2 (identifier: A0PJK1-2) [UniParc]FASTAAdd to Basket

    Also known as: IF3

    The sequence of this isoform differs from the canonical sequence as follows:
         187-213: Missing.

    Show »
    Length:569
    Mass (Da):61,616
    Checksum:i21794598680FDE9F
    GO
    Isoform 3 (identifier: A0PJK1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-56: Missing.
         187-213: Missing.
         327-327: P → PGAHVYEERHQVSVSRT
         414-414: R → RTGIPSTPPAPQSRLSFLLPETPPLERYLLGLVVMDLW

    Note: No experimental confirmation available.

    Show »
    Length:566
    Mass (Da):61,613
    Checksum:iE4C754BBFC76F6C2
    GO
    Isoform 4 (identifier: A0PJK1-4) [UniParc]FASTAAdd to Basket

    Also known as: IF1

    The sequence of this isoform differs from the canonical sequence as follows:
         327-327: P → PGAHVYEERHQVSVSRT

    Show »
    Length:612
    Mass (Da):66,179
    Checksum:iD9B55F5C1B9A97A8
    GO
    Isoform 5 (identifier: A0PJK1-5) [UniParc]FASTAAdd to Basket

    Also known as: IF4

    The sequence of this isoform differs from the canonical sequence as follows:
         328-363: Missing.

    Show »
    Length:560
    Mass (Da):60,577
    Checksum:iB099BDCD16D8B738
    GO

    Sequence cautioni

    The sequence BAB71619.1 differs from that shown. Reason: Frameshift at position 156.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti522 – 5221A → V.
    Corresponds to variant rs12604020 [ dbSNP | Ensembl ].
    VAR_052493

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5656Missing in isoform 3. 1 PublicationVSP_029416Add
    BLAST
    Alternative sequencei187 – 21327Missing in isoform 2 and isoform 3. 1 PublicationVSP_029417Add
    BLAST
    Alternative sequencei327 – 3271P → PGAHVYEERHQVSVSRT in isoform 3 and isoform 4. 2 PublicationsVSP_029418
    Alternative sequencei328 – 36336Missing in isoform 5. 1 PublicationVSP_045061Add
    BLAST
    Alternative sequencei414 – 4141R → RTGIPSTPPAPQSRLSFLLP ETPPLERYLLGLVVMDLW in isoform 3. 1 PublicationVSP_029419

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK057946 mRNA. Translation: BAB71619.1. Sequence problems.
    AK298345 mRNA. Translation: BAG60592.1.
    AC003957 Genomic DNA. No translation available.
    AC090286 Genomic DNA. No translation available.
    BC034380 mRNA. Translation: AAH34380.1.
    BC039868 mRNA. Translation: AAH39868.1.
    BC062617 mRNA. Translation: AAH62617.1.
    CCDSiCCDS11201.2. [A0PJK1-4]
    CCDS42275.1. [A0PJK1-1]
    CCDS59277.1. [A0PJK1-5]
    CCDS59278.1. [A0PJK1-2]
    RefSeqiNP_001035915.1. NM_001042450.2. [A0PJK1-1]
    NP_001257577.1. NM_001270648.1. [A0PJK1-2]
    NP_001257578.1. NM_001270649.1. [A0PJK1-5]
    NP_001269346.1. NM_001282417.1. [A0PJK1-3]
    NP_689564.3. NM_152351.4. [A0PJK1-4]
    XP_006721514.1. XM_006721451.1. [A0PJK1-1]
    UniGeneiHs.462418.

    Genome annotation databases

    EnsembliENST00000317977; ENSP00000324346; ENSG00000154025. [A0PJK1-3]
    ENST00000395643; ENSP00000379005; ENSG00000154025. [A0PJK1-2]
    ENST00000395645; ENSP00000379007; ENSG00000154025. [A0PJK1-1]
    ENST00000395647; ENSP00000379008; ENSG00000154025. [A0PJK1-4]
    ENST00000417251; ENSP00000401875; ENSG00000154025. [A0PJK1-5]
    GeneIDi125206.
    KEGGihsa:125206.
    UCSCiuc002gur.2. human. [A0PJK1-3]
    uc002gut.2. human. [A0PJK1-4]
    uc002guu.2. human. [A0PJK1-1]
    uc002guv.2. human. [A0PJK1-2]
    uc010vyl.2. human.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK057946 mRNA. Translation: BAB71619.1 . Sequence problems.
    AK298345 mRNA. Translation: BAG60592.1 .
    AC003957 Genomic DNA. No translation available.
    AC090286 Genomic DNA. No translation available.
    BC034380 mRNA. Translation: AAH34380.1 .
    BC039868 mRNA. Translation: AAH39868.1 .
    BC062617 mRNA. Translation: AAH62617.1 .
    CCDSi CCDS11201.2. [A0PJK1-4 ]
    CCDS42275.1. [A0PJK1-1 ]
    CCDS59277.1. [A0PJK1-5 ]
    CCDS59278.1. [A0PJK1-2 ]
    RefSeqi NP_001035915.1. NM_001042450.2. [A0PJK1-1 ]
    NP_001257577.1. NM_001270648.1. [A0PJK1-2 ]
    NP_001257578.1. NM_001270649.1. [A0PJK1-5 ]
    NP_001269346.1. NM_001282417.1. [A0PJK1-3 ]
    NP_689564.3. NM_152351.4. [A0PJK1-4 ]
    XP_006721514.1. XM_006721451.1. [A0PJK1-1 ]
    UniGenei Hs.462418.

    3D structure databases

    ProteinModelPortali A0PJK1.
    SMRi A0PJK1. Positions 17-480.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    MINTi MINT-4722994.
    STRINGi 9606.ENSP00000379008.

    Protein family/group databases

    TCDBi 2.A.21.3.15. the solute:sodium symporter (sss) family.

    PTM databases

    PhosphoSitei A0PJK1.

    Proteomic databases

    PaxDbi A0PJK1.
    PRIDEi A0PJK1.

    Protocols and materials databases

    DNASUi 125206.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000317977 ; ENSP00000324346 ; ENSG00000154025 . [A0PJK1-3 ]
    ENST00000395643 ; ENSP00000379005 ; ENSG00000154025 . [A0PJK1-2 ]
    ENST00000395645 ; ENSP00000379007 ; ENSG00000154025 . [A0PJK1-1 ]
    ENST00000395647 ; ENSP00000379008 ; ENSG00000154025 . [A0PJK1-4 ]
    ENST00000417251 ; ENSP00000401875 ; ENSG00000154025 . [A0PJK1-5 ]
    GeneIDi 125206.
    KEGGi hsa:125206.
    UCSCi uc002gur.2. human. [A0PJK1-3 ]
    uc002gut.2. human. [A0PJK1-4 ]
    uc002guu.2. human. [A0PJK1-1 ]
    uc002guv.2. human. [A0PJK1-2 ]
    uc010vyl.2. human.

    Organism-specific databases

    CTDi 125206.
    GeneCardsi GC17P018853.
    H-InvDB HIX0018725.
    HGNCi HGNC:23155. SLC5A10.
    HPAi HPA052014.
    neXtProti NX_A0PJK1.
    PharmGKBi PA134940254.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG4146.
    HOGENOMi HOG000025422.
    HOVERGENi HBG052859.
    KOi K14390.
    OMAi HNERRIK.
    OrthoDBi EOG77126J.
    PhylomeDBi A0PJK1.
    TreeFami TF352855.

    Miscellaneous databases

    ChiTaRSi SLC5A10. human.
    GenomeRNAii 125206.
    NextBioi 35473877.
    PROi A0PJK1.

    Gene expression databases

    Bgeei A0PJK1.
    CleanExi HS_SLC5A10.
    Genevestigatori A0PJK1.

    Family and domain databases

    InterProi IPR001734. Na/solute_symporter.
    IPR018212. Na/solute_symporter_CS.
    IPR019900. Na/solute_symporter_subgr.
    [Graphical view ]
    PANTHERi PTHR11819. PTHR11819. 1 hit.
    Pfami PF00474. SSF. 1 hit.
    [Graphical view ]
    TIGRFAMsi TIGR00813. sss. 1 hit.
    PROSITEi PS00457. NA_SOLUT_SYMP_2. 1 hit.
    PS50283. NA_SOLUT_SYMP_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
      Tissue: Kidney.
    2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3-596 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-596 (ISOFORM 1).
      Tissue: Brain and Colon.
    4. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-141; SER-145 AND THR-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    5. "Functional characterisation of human SGLT-5 as a novel kidney-specific sodium-dependent sugar transporter."
      Grempler R., Augustin R., Froehner S., Hildebrandt T., Simon E., Mark M., Eickelmann P.
      FEBS Lett. 586:248-253(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 4 AND 5).

    Entry informationi

    Entry nameiSC5AA_HUMAN
    AccessioniPrimary (citable) accession number: A0PJK1
    Secondary accession number(s): A8MUC9
    , B4DPI0, B7WPR4, Q6P5X0, Q8IXM4, Q96LQ1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 13, 2007
    Last sequence update: November 13, 2007
    Last modified: October 1, 2014
    This is version 76 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3