Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A0PJK1 (SC5AA_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 75. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sodium/glucose cotransporter 5

Short name=Na(+)/glucose cotransporter 5
Alternative name(s):
Solute carrier family 5 member 10
Gene names
Name:SLC5A10
Synonyms:SGLT5
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length596 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

High capacity transporter for mannose and fructose and, to a lesser extent, glucose, AMG, and galactose. Ref.5

Subcellular location

Cell membrane; Multi-pass membrane protein Ref.5.

Tissue specificity

Seems to be exclusively expressed in kidney. Ref.5

Sequence similarities

Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. [View classification]

Sequence caution

The sequence BAB71619.1 differs from that shown. Reason: Frameshift at position 156.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A0PJK1-1)

Also known as: IF2;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A0PJK1-2)

Also known as: IF3;

The sequence of this isoform differs from the canonical sequence as follows:
     187-213: Missing.
Isoform 3 (identifier: A0PJK1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: Missing.
     187-213: Missing.
     327-327: P → PGAHVYEERHQVSVSRT
     414-414: R → RTGIPSTPPAPQSRLSFLLPETPPLERYLLGLVVMDLW
Note: No experimental confirmation available.
Isoform 4 (identifier: A0PJK1-4)

Also known as: IF1;

The sequence of this isoform differs from the canonical sequence as follows:
     327-327: P → PGAHVYEERHQVSVSRT
Isoform 5 (identifier: A0PJK1-5)

Also known as: IF4;

The sequence of this isoform differs from the canonical sequence as follows:
     328-363: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 596596Sodium/glucose cotransporter 5
PRO_0000311211

Regions

Topological domain1 – 1515Extracellular Potential
Transmembrane16 – 3621Helical; Potential
Topological domain37 – 7236Cytoplasmic Potential
Transmembrane73 – 9321Helical; Potential
Topological domain94 – 996Extracellular Potential
Transmembrane100 – 12021Helical; Potential
Topological domain121 – 14929Cytoplasmic Potential
Transmembrane150 – 17021Helical; Potential
Topological domain171 – 1733Extracellular Potential
Transmembrane174 – 19421Helical; Potential
Topological domain195 – 2006Cytoplasmic Potential
Transmembrane201 – 22121Helical; Potential
Topological domain222 – 26443Extracellular Potential
Transmembrane265 – 28521Helical; Potential
Topological domain286 – 30015Cytoplasmic Potential
Transmembrane301 – 32121Helical; Potential
Topological domain322 – 35534Extracellular Potential
Transmembrane356 – 37621Helical; Potential
Topological domain377 – 40933Cytoplasmic Potential
Transmembrane410 – 43021Helical; Potential
Topological domain431 – 44313Extracellular Potential
Transmembrane444 – 46421Helical; Potential
Topological domain465 – 4717Cytoplasmic Potential
Transmembrane472 – 49221Helical; Potential
Topological domain493 – 51321Extracellular Potential
Transmembrane514 – 53421Helical; Potential
Topological domain535 – 57541Cytoplasmic Potential
Transmembrane576 – 59621Helical; Potential

Amino acid modifications

Modified residue1411Phosphoserine Ref.4
Modified residue1451Phosphoserine Ref.4
Modified residue1481Phosphothreonine Ref.4
Glycosylation41N-linked (GlcNAc...) Potential
Glycosylation961N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 5656Missing in isoform 3.
VSP_029416
Alternative sequence187 – 21327Missing in isoform 2 and isoform 3.
VSP_029417
Alternative sequence3271P → PGAHVYEERHQVSVSRT in isoform 3 and isoform 4.
VSP_029418
Alternative sequence328 – 36336Missing in isoform 5.
VSP_045061
Alternative sequence4141R → RTGIPSTPPAPQSRLSFLLP ETPPLERYLLGLVVMDLW in isoform 3.
VSP_029419
Natural variant5221A → V.
Corresponds to variant rs12604020 [ dbSNP | Ensembl ].
VAR_052493

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (IF2) [UniParc].

Last modified November 13, 2007. Version 2.
Checksum: 73D104A9F8065926

FASTA59664,342
        10         20         30         40         50         60 
MAANSTSDLH TPGTQLSVAD IIVITVYFAL NVAVGIWSSC RASRNTVNGY FLAGRDMTWW 

        70         80         90        100        110        120 
PIGASLFASS EGSGLFIGLA GSGAAGGLAV AGFEWNATYV LLALAWVFVP IYISSEIVTL 

       130        140        150        160        170        180 
PEYIQKRYGG QRIRMYLSVL SLLLSVFTKI SLDLYAGALF VHICLGWNFY LSTILTLGIT 

       190        200        210        220        230        240 
ALYTIAGGLA AVIYTDALQT LIMVVGAVIL TIKAFDQIGG YGQLEAAYAQ AIPSRTIANT 

       250        260        270        280        290        300 
TCHLPRTDAM HMFRDPHTGD LPWTGMTFGL TIMATWYWCT DQVIVQRSLS ARDLNHAKAG 

       310        320        330        340        350        360 
SILASYLKML PMGLIIMPGM ISRALFPDDV GCVVPSECLR ACGAEVGCSN IAYPKLVMEL 

       370        380        390        400        410        420 
MPIGLRGLMI AVMLAALMSS LTSIFNSSST LFTMDIWRRL RPRSGERELL LVGRLVIVAL 

       430        440        450        460        470        480 
IGVSVAWIPV LQDSNSGQLF IYMQSVTSSL APPVTAVFVL GVFWRRANEQ GAFWGLIAGL 

       490        500        510        520        530        540 
VVGATRLVLE FLNPAPPCGE PDTRPAVLGS IHYLHFAVAL FALSGAVVVA GSLLTPPPQS 

       550        560        570        580        590 
VQIENLTWWT LAQDVPLGTK AGDGQTPQKH AFWARVCGFN AILLMCVNIF FYAYFA 

« Hide

Isoform 2 (IF3) [UniParc].

Checksum: 21794598680FDE9F
Show »

FASTA56961,616
Isoform 3 [UniParc].

Checksum: E4C754BBFC76F6C2
Show »

FASTA56661,613
Isoform 4 (IF1) [UniParc].

Checksum: D9B55F5C1B9A97A8
Show »

FASTA61266,179
Isoform 5 (IF4) [UniParc].

Checksum: B099BDCD16D8B738
Show »

FASTA56060,577

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
Tissue: Kidney.
[2]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3-596 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-596 (ISOFORM 1).
Tissue: Brain and Colon.
[4]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-141; SER-145 AND THR-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[5]"Functional characterisation of human SGLT-5 as a novel kidney-specific sodium-dependent sugar transporter."
Grempler R., Augustin R., Froehner S., Hildebrandt T., Simon E., Mark M., Eickelmann P.
FEBS Lett. 586:248-253(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 4 AND 5).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK057946 mRNA. Translation: BAB71619.1. Sequence problems.
AK298345 mRNA. Translation: BAG60592.1.
AC003957 Genomic DNA. No translation available.
AC090286 Genomic DNA. No translation available.
BC034380 mRNA. Translation: AAH34380.1.
BC039868 mRNA. Translation: AAH39868.1.
BC062617 mRNA. Translation: AAH62617.1.
CCDSCCDS11201.2. [A0PJK1-4]
CCDS42275.1. [A0PJK1-1]
CCDS59277.1. [A0PJK1-5]
CCDS59278.1. [A0PJK1-2]
RefSeqNP_001035915.1. NM_001042450.2. [A0PJK1-1]
NP_001257577.1. NM_001270648.1. [A0PJK1-2]
NP_001257578.1. NM_001270649.1. [A0PJK1-5]
NP_001269346.1. NM_001282417.1. [A0PJK1-3]
NP_689564.3. NM_152351.4. [A0PJK1-4]
XP_006721514.1. XM_006721451.1. [A0PJK1-1]
UniGeneHs.462418.

3D structure databases

ProteinModelPortalA0PJK1.
SMRA0PJK1. Positions 17-480.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

MINTMINT-4722994.
STRING9606.ENSP00000379008.

Protein family/group databases

TCDB2.A.21.3.15. the solute:sodium symporter (sss) family.

PTM databases

PhosphoSiteA0PJK1.

Proteomic databases

PaxDbA0PJK1.
PRIDEA0PJK1.

Protocols and materials databases

DNASU125206.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000317977; ENSP00000324346; ENSG00000154025. [A0PJK1-3]
ENST00000395642; ENSP00000379004; ENSG00000154025. [A0PJK1-3]
ENST00000395643; ENSP00000379005; ENSG00000154025. [A0PJK1-2]
ENST00000395645; ENSP00000379007; ENSG00000154025. [A0PJK1-1]
ENST00000395647; ENSP00000379008; ENSG00000154025. [A0PJK1-4]
ENST00000417251; ENSP00000401875; ENSG00000154025. [A0PJK1-5]
GeneID125206.
KEGGhsa:125206.
UCSCuc002gur.2. human. [A0PJK1-3]
uc002gut.2. human. [A0PJK1-4]
uc002guu.2. human. [A0PJK1-1]
uc002guv.2. human. [A0PJK1-2]
uc010vyl.2. human.

Organism-specific databases

CTD125206.
GeneCardsGC17P018853.
H-InvDBHIX0018725.
HGNCHGNC:23155. SLC5A10.
HPAHPA052014.
neXtProtNX_A0PJK1.
PharmGKBPA134940254.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG4146.
HOGENOMHOG000025422.
HOVERGENHBG052859.
KOK14390.
OMAHNERRIK.
OrthoDBEOG77126J.
PhylomeDBA0PJK1.
TreeFamTF352855.

Gene expression databases

BgeeA0PJK1.
CleanExHS_SLC5A10.
GenevestigatorA0PJK1.

Family and domain databases

InterProIPR001734. Na/solute_symporter.
IPR018212. Na/solute_symporter_CS.
IPR019900. Na/solute_symporter_subgr.
[Graphical view]
PANTHERPTHR11819. PTHR11819. 1 hit.
PfamPF00474. SSF. 1 hit.
[Graphical view]
TIGRFAMsTIGR00813. sss. 1 hit.
PROSITEPS00457. NA_SOLUT_SYMP_2. 1 hit.
PS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSLC5A10. human.
GenomeRNAi125206.
NextBio35473877.
PROA0PJK1.

Entry information

Entry nameSC5AA_HUMAN
AccessionPrimary (citable) accession number: A0PJK1
Secondary accession number(s): A8MUC9 expand/collapse secondary AC list , B4DPI0, B7WPR4, Q6P5X0, Q8IXM4, Q96LQ1
Entry history
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: July 9, 2014
This is version 75 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM