A0PJK1 (SC5AA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 62.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sodium/glucose cotransporter 5 Short name=Na(+)/glucose cotransporter 5 Alternative name(s): Solute carrier family 5 member 10 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 596 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | High capacity transporter for mannose and fructose and, to a lesser extent, glucose, AMG, and galactose. Ref.5 |
| Subcellular location | |
| Tissue specificity | Seems to be exclusively expressed in kidney. Ref.5 |
| Sequence similarities | Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. [View classification] |
| Sequence caution | The sequence BAB71619.1 differs from that shown. Reason: Frameshift at position 156. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Sodium transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Sodium |
| PTM | Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | sodium ion transport Inferred from electronic annotation. Source: UniProtKB-KW transmembrane transportInferred from electronic annotation. Source: InterPro |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | transporter activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A0PJK1-1) Also known as: IF2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A0PJK1-2) Also known as: IF3; The sequence of this isoform differs from the canonical sequence as follows: 187-213: Missing. | ||||||
| Isoform 3 (identifier: A0PJK1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-56: Missing. 187-213: Missing. 327-327: P → PGAHVYEERHQVSVSRT 414-414: R → RTGIPSTPPAPQSRLSFLLPETPPLERYLLGLVVMDLW | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: A0PJK1-4) Also known as: IF1; The sequence of this isoform differs from the canonical sequence as follows: 327-327: P → PGAHVYEERHQVSVSRT | ||||||
| Isoform 5 (identifier: A0PJK1-5) Also known as: IF4; The sequence of this isoform differs from the canonical sequence as follows: 328-363: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 596 | 596 | Sodium/glucose cotransporter 5 | PRO_0000311211 | |||||
Regions | |||||||||
| Topological domain | 1 – 15 | 15 | Extracellular Potential | ||||||
| Transmembrane | 16 – 36 | 21 | Helical; Potential | ||||||
| Topological domain | 37 – 72 | 36 | Cytoplasmic Potential | ||||||
| Transmembrane | 73 – 93 | 21 | Helical; Potential | ||||||
| Topological domain | 94 – 99 | 6 | Extracellular Potential | ||||||
| Transmembrane | 100 – 120 | 21 | Helical; Potential | ||||||
| Topological domain | 121 – 149 | 29 | Cytoplasmic Potential | ||||||
| Transmembrane | 150 – 170 | 21 | Helical; Potential | ||||||
| Topological domain | 171 – 173 | 3 | Extracellular Potential | ||||||
| Transmembrane | 174 – 194 | 21 | Helical; Potential | ||||||
| Topological domain | 195 – 200 | 6 | Cytoplasmic Potential | ||||||
| Transmembrane | 201 – 221 | 21 | Helical; Potential | ||||||
| Topological domain | 222 – 264 | 43 | Extracellular Potential | ||||||
| Transmembrane | 265 – 285 | 21 | Helical; Potential | ||||||
| Topological domain | 286 – 300 | 15 | Cytoplasmic Potential | ||||||
| Transmembrane | 301 – 321 | 21 | Helical; Potential | ||||||
| Topological domain | 322 – 355 | 34 | Extracellular Potential | ||||||
| Transmembrane | 356 – 376 | 21 | Helical; Potential | ||||||
| Topological domain | 377 – 409 | 33 | Cytoplasmic Potential | ||||||
| Transmembrane | 410 – 430 | 21 | Helical; Potential | ||||||
| Topological domain | 431 – 443 | 13 | Extracellular Potential | ||||||
| Transmembrane | 444 – 464 | 21 | Helical; Potential | ||||||
| Topological domain | 465 – 471 | 7 | Cytoplasmic Potential | ||||||
| Transmembrane | 472 – 492 | 21 | Helical; Potential | ||||||
| Topological domain | 493 – 513 | 21 | Extracellular Potential | ||||||
| Transmembrane | 514 – 534 | 21 | Helical; Potential | ||||||
| Topological domain | 535 – 575 | 41 | Cytoplasmic Potential | ||||||
| Transmembrane | 576 – 596 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 141 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 145 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 148 | 1 | Phosphothreonine Ref.4 | ||||||
| Glycosylation | 4 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 96 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 56 | 56 | Missing in isoform 3. | VSP_029416 | |||||
| Alternative sequence | 187 – 213 | 27 | Missing in isoform 2 and isoform 3. | VSP_029417 | |||||
| Alternative sequence | 327 | 1 | P → PGAHVYEERHQVSVSRT in isoform 3 and isoform 4. | VSP_029418 | |||||
| Alternative sequence | 328 – 363 | 36 | Missing in isoform 5. | VSP_045061 | |||||
| Alternative sequence | 414 | 1 | R → RTGIPSTPPAPQSRLSFLLP ETPPLERYLLGLVVMDLW in isoform 3. | VSP_029419 | |||||
| Natural variant | 522 | 1 | A → V. Corresponds to variant rs12604020 [ dbSNP | Ensembl ]. | VAR_052493 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5). Tissue: Kidney. |
| [2] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3-596 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-596 (ISOFORM 1). Tissue: Brain and Colon. |
| [4] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-141; SER-145 AND THR-148, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [5] | "Functional characterisation of human SGLT-5 as a novel kidney-specific sodium-dependent sugar transporter." Grempler R., Augustin R., Froehner S., Hildebrandt T., Simon E., Mark M., Eickelmann P. FEBS Lett. 586:248-253(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 4 AND 5). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK057946 mRNA. Translation: BAB71619.1. Sequence problems. AK298345 mRNA. Translation: BAG60592.1. AC003957 Genomic DNA. No translation available. AC090286 Genomic DNA. No translation available. BC034380 mRNA. Translation: AAH34380.1. BC039868 mRNA. Translation: AAH39868.1. BC062617 mRNA. Translation: AAH62617.1. |
| IPI | IPI00217554. IPI00441079. IPI00791625. IPI00873252. IPI00888822. |
| RefSeq | NP_001035915.1. NM_001042450.2. NP_001257577.1. NM_001270648.1. NP_001257578.1. NM_001270649.1. NP_689564.3. NM_152351.4. |
| UniGene | Hs.462418. |
3D structure databases | |
| ProteinModelPortal | A0PJK1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000379008. |
PTM databases | |
| PhosphoSite | A0PJK1. |
Proteomic databases | |
| PaxDb | A0PJK1. |
| PRIDE | A0PJK1. |
Protocols and materials databases | |
| DNASU | 125206. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000317977; ENSP00000324346; ENSG00000154025. ENST00000395642; ENSP00000379004; ENSG00000154025. ENST00000395643; ENSP00000379005; ENSG00000154025. ENST00000395645; ENSP00000379007; ENSG00000154025. ENST00000395647; ENSP00000379008; ENSG00000154025. ENST00000417251; ENSP00000401875; ENSG00000154025. |
| GeneID | 125206. |
| KEGG | hsa:125206. |
| UCSC | uc002gur.1. human. uc002gut.1. human. uc002guu.1. human. uc002guv.1. human. |
Organism-specific databases | |
| CTD | 125206. |
| GeneCards | GC17P018853. |
| H-InvDB | HIX0018725. |
| HGNC | HGNC:23155. SLC5A10. |
| HPA | HPA052014. |
| neXtProt | NX_A0PJK1. |
| PharmGKB | PA134940254. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG4146. |
| HOGENOM | HOG000025422. |
| HOVERGEN | HBG052859. |
| KO | K14390. |
| OMA | QAYPEMM. |
Gene expression databases | |
| ArrayExpress | A0PJK1. |
| Bgee | A0PJK1. |
| CleanEx | HS_SLC5A10. |
| Genevestigator | A0PJK1. |
Family and domain databases | |
| InterPro | IPR001734. Na/solute_symporter. IPR018212. Na/solute_symporter_CS. IPR019900. Na/solute_symporter_subgr. [Graphical view] |
| PANTHER | PTHR11819. PTHR11819. 1 hit. |
| Pfam | PF00474. SSF. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR00813. sss. 1 hit. |
| PROSITE | PS00457. NA_SOLUT_SYMP_2. 1 hit. PS50283. NA_SOLUT_SYMP_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SLC5A10. human. |
| GenomeRNAi | 125206. |
| NextBio | 35473877. |
Entry information
| Entry name | SC5AA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A0PJK1 Secondary accession number(s): A8MUC9 Q96LQ1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
