Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/glucose cotransporter 5

Gene

SLC5A10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

High capacity transporter for mannose and fructose and, to a lesser extent, glucose, AMG, and galactose.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

ReactomeiR-HSA-189200. Hexose transport.

Protein family/group databases

TCDBi2.A.21.3.15. the solute:sodium symporter (sss) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/glucose cotransporter 5
Short name:
Na(+)/glucose cotransporter 5
Alternative name(s):
Solute carrier family 5 member 10
Gene namesi
Name:SLC5A10
Synonyms:SGLT5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:23155. SLC5A10.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 15ExtracellularSequence analysisAdd BLAST15
Transmembranei16 – 36HelicalSequence analysisAdd BLAST21
Topological domaini37 – 72CytoplasmicSequence analysisAdd BLAST36
Transmembranei73 – 93HelicalSequence analysisAdd BLAST21
Topological domaini94 – 99ExtracellularSequence analysis6
Transmembranei100 – 120HelicalSequence analysisAdd BLAST21
Topological domaini121 – 149CytoplasmicSequence analysisAdd BLAST29
Transmembranei150 – 170HelicalSequence analysisAdd BLAST21
Topological domaini171 – 173ExtracellularSequence analysis3
Transmembranei174 – 194HelicalSequence analysisAdd BLAST21
Topological domaini195 – 200CytoplasmicSequence analysis6
Transmembranei201 – 221HelicalSequence analysisAdd BLAST21
Topological domaini222 – 264ExtracellularSequence analysisAdd BLAST43
Transmembranei265 – 285HelicalSequence analysisAdd BLAST21
Topological domaini286 – 300CytoplasmicSequence analysisAdd BLAST15
Transmembranei301 – 321HelicalSequence analysisAdd BLAST21
Topological domaini322 – 355ExtracellularSequence analysisAdd BLAST34
Transmembranei356 – 376HelicalSequence analysisAdd BLAST21
Topological domaini377 – 409CytoplasmicSequence analysisAdd BLAST33
Transmembranei410 – 430HelicalSequence analysisAdd BLAST21
Topological domaini431 – 443ExtracellularSequence analysisAdd BLAST13
Transmembranei444 – 464HelicalSequence analysisAdd BLAST21
Topological domaini465 – 471CytoplasmicSequence analysis7
Transmembranei472 – 492HelicalSequence analysisAdd BLAST21
Topological domaini493 – 513ExtracellularSequence analysisAdd BLAST21
Transmembranei514 – 534HelicalSequence analysisAdd BLAST21
Topological domaini535 – 575CytoplasmicSequence analysisAdd BLAST41
Transmembranei576 – 596HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • integral component of plasma membrane Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000154025.
PharmGKBiPA134940254.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003112111 – 596Sodium/glucose cotransporter 5Add BLAST596

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi4N-linked (GlcNAc...)Sequence analysis1
Glycosylationi96N-linked (GlcNAc...)Sequence analysis1
Modified residuei141PhosphoserineCombined sources1
Modified residuei145PhosphoserineCombined sources1
Modified residuei148PhosphothreonineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiA0PJK1.
PRIDEiA0PJK1.

PTM databases

iPTMnetiA0PJK1.
PhosphoSitePlusiA0PJK1.

Expressioni

Tissue specificityi

Seems to be exclusively expressed in kidney.1 Publication

Gene expression databases

BgeeiENSG00000154025.
CleanExiHS_SLC5A10.
GenevisibleiA0PJK1. HS.

Organism-specific databases

HPAiHPA052014.

Interactioni

Protein-protein interaction databases

MINTiMINT-4722994.
STRINGi9606.ENSP00000379008.

Structurei

3D structure databases

ProteinModelPortaliA0PJK1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IP49. Eukaryota.
COG4146. LUCA.
GeneTreeiENSGT00760000118955.
HOGENOMiHOG000025422.
HOVERGENiHBG052859.
InParanoidiA0PJK1.
KOiK14390.
OMAiIFWQRAN.
OrthoDBiEOG091G077U.
PhylomeDBiA0PJK1.
TreeFamiTF352855.

Family and domain databases

InterProiIPR001734. Na/solute_symporter.
IPR018212. Na/solute_symporter_CS.
[Graphical view]
PANTHERiPTHR11819. PTHR11819. 1 hit.
PfamiPF00474. SSF. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00813. sss. 1 hit.
PROSITEiPS00457. NA_SOLUT_SYMP_2. 1 hit.
PS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A0PJK1-1) [UniParc]FASTAAdd to basket
Also known as: IF2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAANSTSDLH TPGTQLSVAD IIVITVYFAL NVAVGIWSSC RASRNTVNGY
60 70 80 90 100
FLAGRDMTWW PIGASLFASS EGSGLFIGLA GSGAAGGLAV AGFEWNATYV
110 120 130 140 150
LLALAWVFVP IYISSEIVTL PEYIQKRYGG QRIRMYLSVL SLLLSVFTKI
160 170 180 190 200
SLDLYAGALF VHICLGWNFY LSTILTLGIT ALYTIAGGLA AVIYTDALQT
210 220 230 240 250
LIMVVGAVIL TIKAFDQIGG YGQLEAAYAQ AIPSRTIANT TCHLPRTDAM
260 270 280 290 300
HMFRDPHTGD LPWTGMTFGL TIMATWYWCT DQVIVQRSLS ARDLNHAKAG
310 320 330 340 350
SILASYLKML PMGLIIMPGM ISRALFPDDV GCVVPSECLR ACGAEVGCSN
360 370 380 390 400
IAYPKLVMEL MPIGLRGLMI AVMLAALMSS LTSIFNSSST LFTMDIWRRL
410 420 430 440 450
RPRSGERELL LVGRLVIVAL IGVSVAWIPV LQDSNSGQLF IYMQSVTSSL
460 470 480 490 500
APPVTAVFVL GVFWRRANEQ GAFWGLIAGL VVGATRLVLE FLNPAPPCGE
510 520 530 540 550
PDTRPAVLGS IHYLHFAVAL FALSGAVVVA GSLLTPPPQS VQIENLTWWT
560 570 580 590
LAQDVPLGTK AGDGQTPQKH AFWARVCGFN AILLMCVNIF FYAYFA
Length:596
Mass (Da):64,342
Last modified:November 13, 2007 - v2
Checksum:i73D104A9F8065926
GO
Isoform 2 (identifier: A0PJK1-2) [UniParc]FASTAAdd to basket
Also known as: IF3

The sequence of this isoform differs from the canonical sequence as follows:
     187-213: Missing.

Show »
Length:569
Mass (Da):61,616
Checksum:i21794598680FDE9F
GO
Isoform 3 (identifier: A0PJK1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: Missing.
     187-213: Missing.
     327-327: P → PGAHVYEERHQVSVSRT
     414-414: R → RTGIPSTPPAPQSRLSFLLPETPPLERYLLGLVVMDLW

Note: No experimental confirmation available.
Show »
Length:566
Mass (Da):61,613
Checksum:iE4C754BBFC76F6C2
GO
Isoform 4 (identifier: A0PJK1-4) [UniParc]FASTAAdd to basket
Also known as: IF1

The sequence of this isoform differs from the canonical sequence as follows:
     327-327: P → PGAHVYEERHQVSVSRT

Show »
Length:612
Mass (Da):66,179
Checksum:iD9B55F5C1B9A97A8
GO
Isoform 5 (identifier: A0PJK1-5) [UniParc]FASTAAdd to basket
Also known as: IF4

The sequence of this isoform differs from the canonical sequence as follows:
     328-363: Missing.

Show »
Length:560
Mass (Da):60,577
Checksum:iB099BDCD16D8B738
GO

Sequence cautioni

The sequence BAB71619 differs from that shown. Reason: Frameshift at position 156.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052493522A → V.Corresponds to variant rs12604020dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0294161 – 56Missing in isoform 3. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_029417187 – 213Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_029418327P → PGAHVYEERHQVSVSRT in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_045061328 – 363Missing in isoform 5. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_029419414R → RTGIPSTPPAPQSRLSFLLP ETPPLERYLLGLVVMDLW in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057946 mRNA. Translation: BAB71619.1. Sequence problems.
AK298345 mRNA. Translation: BAG60592.1.
AC003957 Genomic DNA. No translation available.
AC090286 Genomic DNA. No translation available.
BC034380 mRNA. Translation: AAH34380.1.
BC039868 mRNA. Translation: AAH39868.1.
BC062617 mRNA. Translation: AAH62617.1.
CCDSiCCDS11201.2. [A0PJK1-4]
CCDS42275.1. [A0PJK1-1]
CCDS59277.1. [A0PJK1-5]
CCDS59278.1. [A0PJK1-2]
CCDS74008.1. [A0PJK1-3]
RefSeqiNP_001035915.1. NM_001042450.2. [A0PJK1-1]
NP_001257577.1. NM_001270648.1. [A0PJK1-2]
NP_001257578.1. NM_001270649.1. [A0PJK1-5]
NP_001269346.1. NM_001282417.1. [A0PJK1-3]
NP_689564.3. NM_152351.4. [A0PJK1-4]
UniGeneiHs.462418.

Genome annotation databases

EnsembliENST00000317977; ENSP00000324346; ENSG00000154025. [A0PJK1-3]
ENST00000395643; ENSP00000379005; ENSG00000154025. [A0PJK1-2]
ENST00000395645; ENSP00000379007; ENSG00000154025. [A0PJK1-1]
ENST00000395647; ENSP00000379008; ENSG00000154025. [A0PJK1-4]
ENST00000417251; ENSP00000401875; ENSG00000154025. [A0PJK1-5]
GeneIDi125206.
KEGGihsa:125206.
UCSCiuc002gur.3. human. [A0PJK1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057946 mRNA. Translation: BAB71619.1. Sequence problems.
AK298345 mRNA. Translation: BAG60592.1.
AC003957 Genomic DNA. No translation available.
AC090286 Genomic DNA. No translation available.
BC034380 mRNA. Translation: AAH34380.1.
BC039868 mRNA. Translation: AAH39868.1.
BC062617 mRNA. Translation: AAH62617.1.
CCDSiCCDS11201.2. [A0PJK1-4]
CCDS42275.1. [A0PJK1-1]
CCDS59277.1. [A0PJK1-5]
CCDS59278.1. [A0PJK1-2]
CCDS74008.1. [A0PJK1-3]
RefSeqiNP_001035915.1. NM_001042450.2. [A0PJK1-1]
NP_001257577.1. NM_001270648.1. [A0PJK1-2]
NP_001257578.1. NM_001270649.1. [A0PJK1-5]
NP_001269346.1. NM_001282417.1. [A0PJK1-3]
NP_689564.3. NM_152351.4. [A0PJK1-4]
UniGeneiHs.462418.

3D structure databases

ProteinModelPortaliA0PJK1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-4722994.
STRINGi9606.ENSP00000379008.

Protein family/group databases

TCDBi2.A.21.3.15. the solute:sodium symporter (sss) family.

PTM databases

iPTMnetiA0PJK1.
PhosphoSitePlusiA0PJK1.

Proteomic databases

PaxDbiA0PJK1.
PRIDEiA0PJK1.

Protocols and materials databases

DNASUi125206.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317977; ENSP00000324346; ENSG00000154025. [A0PJK1-3]
ENST00000395643; ENSP00000379005; ENSG00000154025. [A0PJK1-2]
ENST00000395645; ENSP00000379007; ENSG00000154025. [A0PJK1-1]
ENST00000395647; ENSP00000379008; ENSG00000154025. [A0PJK1-4]
ENST00000417251; ENSP00000401875; ENSG00000154025. [A0PJK1-5]
GeneIDi125206.
KEGGihsa:125206.
UCSCiuc002gur.3. human. [A0PJK1-1]

Organism-specific databases

CTDi125206.
GeneCardsiSLC5A10.
H-InvDBHIX0018725.
HGNCiHGNC:23155. SLC5A10.
HPAiHPA052014.
neXtProtiNX_A0PJK1.
OpenTargetsiENSG00000154025.
PharmGKBiPA134940254.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IP49. Eukaryota.
COG4146. LUCA.
GeneTreeiENSGT00760000118955.
HOGENOMiHOG000025422.
HOVERGENiHBG052859.
InParanoidiA0PJK1.
KOiK14390.
OMAiIFWQRAN.
OrthoDBiEOG091G077U.
PhylomeDBiA0PJK1.
TreeFamiTF352855.

Enzyme and pathway databases

ReactomeiR-HSA-189200. Hexose transport.

Miscellaneous databases

ChiTaRSiSLC5A10. human.
GenomeRNAii125206.
PROiA0PJK1.

Gene expression databases

BgeeiENSG00000154025.
CleanExiHS_SLC5A10.
GenevisibleiA0PJK1. HS.

Family and domain databases

InterProiIPR001734. Na/solute_symporter.
IPR018212. Na/solute_symporter_CS.
[Graphical view]
PANTHERiPTHR11819. PTHR11819. 1 hit.
PfamiPF00474. SSF. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00813. sss. 1 hit.
PROSITEiPS00457. NA_SOLUT_SYMP_2. 1 hit.
PS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSC5AA_HUMAN
AccessioniPrimary (citable) accession number: A0PJK1
Secondary accession number(s): A8MUC9
, B4DPI0, B7WPR4, Q6P5X0, Q8IXM4, Q96LQ1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: November 30, 2016
This is version 94 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.