SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A0PJK1

- SC5AA_HUMAN

UniProt

A0PJK1 - SC5AA_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Sodium/glucose cotransporter 5
Gene
SLC5A10, SGLT5
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

High capacity transporter for mannose and fructose and, to a lesser extent, glucose, AMG, and galactose.1 Publication

GO - Molecular functioni

  1. transporter activity Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. sodium ion transport Source: UniProtKB-KW
  2. transmembrane transport Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Transport

Keywords - Ligandi

Sodium

Protein family/group databases

TCDBi2.A.21.3.15. the solute:sodium symporter (sss) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/glucose cotransporter 5
Short name:
Na(+)/glucose cotransporter 5
Alternative name(s):
Solute carrier family 5 member 10
Gene namesi
Name:SLC5A10
Synonyms:SGLT5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:23155. SLC5A10.

Subcellular locationi

Cell membrane; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1515Extracellular Reviewed prediction
Add
BLAST
Transmembranei16 – 3621Helical; Reviewed prediction
Add
BLAST
Topological domaini37 – 7236Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei73 – 9321Helical; Reviewed prediction
Add
BLAST
Topological domaini94 – 996Extracellular Reviewed prediction
Transmembranei100 – 12021Helical; Reviewed prediction
Add
BLAST
Topological domaini121 – 14929Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei150 – 17021Helical; Reviewed prediction
Add
BLAST
Topological domaini171 – 1733Extracellular Reviewed prediction
Transmembranei174 – 19421Helical; Reviewed prediction
Add
BLAST
Topological domaini195 – 2006Cytoplasmic Reviewed prediction
Transmembranei201 – 22121Helical; Reviewed prediction
Add
BLAST
Topological domaini222 – 26443Extracellular Reviewed prediction
Add
BLAST
Transmembranei265 – 28521Helical; Reviewed prediction
Add
BLAST
Topological domaini286 – 30015Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei301 – 32121Helical; Reviewed prediction
Add
BLAST
Topological domaini322 – 35534Extracellular Reviewed prediction
Add
BLAST
Transmembranei356 – 37621Helical; Reviewed prediction
Add
BLAST
Topological domaini377 – 40933Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei410 – 43021Helical; Reviewed prediction
Add
BLAST
Topological domaini431 – 44313Extracellular Reviewed prediction
Add
BLAST
Transmembranei444 – 46421Helical; Reviewed prediction
Add
BLAST
Topological domaini465 – 4717Cytoplasmic Reviewed prediction
Transmembranei472 – 49221Helical; Reviewed prediction
Add
BLAST
Topological domaini493 – 51321Extracellular Reviewed prediction
Add
BLAST
Transmembranei514 – 53421Helical; Reviewed prediction
Add
BLAST
Topological domaini535 – 57541Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei576 – 59621Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. integral component of membrane Source: UniProtKB-KW
  3. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134940254.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 596596Sodium/glucose cotransporter 5
PRO_0000311211Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi4 – 41N-linked (GlcNAc...) Reviewed prediction
Glycosylationi96 – 961N-linked (GlcNAc...) Reviewed prediction
Modified residuei141 – 1411Phosphoserine1 Publication
Modified residuei145 – 1451Phosphoserine1 Publication
Modified residuei148 – 1481Phosphothreonine1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiA0PJK1.
PRIDEiA0PJK1.

PTM databases

PhosphoSiteiA0PJK1.

Expressioni

Tissue specificityi

Seems to be exclusively expressed in kidney.1 Publication

Gene expression databases

BgeeiA0PJK1.
CleanExiHS_SLC5A10.
GenevestigatoriA0PJK1.

Organism-specific databases

HPAiHPA052014.

Interactioni

Protein-protein interaction databases

MINTiMINT-4722994.
STRINGi9606.ENSP00000379008.

Structurei

3D structure databases

ProteinModelPortaliA0PJK1.
SMRiA0PJK1. Positions 17-480.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG4146.
HOGENOMiHOG000025422.
HOVERGENiHBG052859.
KOiK14390.
OMAiHNERRIK.
OrthoDBiEOG77126J.
PhylomeDBiA0PJK1.
TreeFamiTF352855.

Family and domain databases

InterProiIPR001734. Na/solute_symporter.
IPR018212. Na/solute_symporter_CS.
IPR019900. Na/solute_symporter_subgr.
[Graphical view]
PANTHERiPTHR11819. PTHR11819. 1 hit.
PfamiPF00474. SSF. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00813. sss. 1 hit.
PROSITEiPS00457. NA_SOLUT_SYMP_2. 1 hit.
PS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A0PJK1-1) [UniParc]FASTAAdd to Basket

Also known as: IF2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAANSTSDLH TPGTQLSVAD IIVITVYFAL NVAVGIWSSC RASRNTVNGY    50
FLAGRDMTWW PIGASLFASS EGSGLFIGLA GSGAAGGLAV AGFEWNATYV 100
LLALAWVFVP IYISSEIVTL PEYIQKRYGG QRIRMYLSVL SLLLSVFTKI 150
SLDLYAGALF VHICLGWNFY LSTILTLGIT ALYTIAGGLA AVIYTDALQT 200
LIMVVGAVIL TIKAFDQIGG YGQLEAAYAQ AIPSRTIANT TCHLPRTDAM 250
HMFRDPHTGD LPWTGMTFGL TIMATWYWCT DQVIVQRSLS ARDLNHAKAG 300
SILASYLKML PMGLIIMPGM ISRALFPDDV GCVVPSECLR ACGAEVGCSN 350
IAYPKLVMEL MPIGLRGLMI AVMLAALMSS LTSIFNSSST LFTMDIWRRL 400
RPRSGERELL LVGRLVIVAL IGVSVAWIPV LQDSNSGQLF IYMQSVTSSL 450
APPVTAVFVL GVFWRRANEQ GAFWGLIAGL VVGATRLVLE FLNPAPPCGE 500
PDTRPAVLGS IHYLHFAVAL FALSGAVVVA GSLLTPPPQS VQIENLTWWT 550
LAQDVPLGTK AGDGQTPQKH AFWARVCGFN AILLMCVNIF FYAYFA 596
Length:596
Mass (Da):64,342
Last modified:November 13, 2007 - v2
Checksum:i73D104A9F8065926
GO
Isoform 2 (identifier: A0PJK1-2) [UniParc]FASTAAdd to Basket

Also known as: IF3

The sequence of this isoform differs from the canonical sequence as follows:
     187-213: Missing.

Show »
Length:569
Mass (Da):61,616
Checksum:i21794598680FDE9F
GO
Isoform 3 (identifier: A0PJK1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: Missing.
     187-213: Missing.
     327-327: P → PGAHVYEERHQVSVSRT
     414-414: R → RTGIPSTPPAPQSRLSFLLPETPPLERYLLGLVVMDLW

Note: No experimental confirmation available.

Show »
Length:566
Mass (Da):61,613
Checksum:iE4C754BBFC76F6C2
GO
Isoform 4 (identifier: A0PJK1-4) [UniParc]FASTAAdd to Basket

Also known as: IF1

The sequence of this isoform differs from the canonical sequence as follows:
     327-327: P → PGAHVYEERHQVSVSRT

Show »
Length:612
Mass (Da):66,179
Checksum:iD9B55F5C1B9A97A8
GO
Isoform 5 (identifier: A0PJK1-5) [UniParc]FASTAAdd to Basket

Also known as: IF4

The sequence of this isoform differs from the canonical sequence as follows:
     328-363: Missing.

Show »
Length:560
Mass (Da):60,577
Checksum:iB099BDCD16D8B738
GO

Sequence cautioni

The sequence BAB71619.1 differs from that shown. Reason: Frameshift at position 156.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti522 – 5221A → V.
Corresponds to variant rs12604020 [ dbSNP | Ensembl ].
VAR_052493

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5656Missing in isoform 3.
VSP_029416Add
BLAST
Alternative sequencei187 – 21327Missing in isoform 2 and isoform 3.
VSP_029417Add
BLAST
Alternative sequencei327 – 3271P → PGAHVYEERHQVSVSRT in isoform 3 and isoform 4.
VSP_029418
Alternative sequencei328 – 36336Missing in isoform 5.
VSP_045061Add
BLAST
Alternative sequencei414 – 4141R → RTGIPSTPPAPQSRLSFLLP ETPPLERYLLGLVVMDLW in isoform 3.
VSP_029419

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK057946 mRNA. Translation: BAB71619.1. Sequence problems.
AK298345 mRNA. Translation: BAG60592.1.
AC003957 Genomic DNA. No translation available.
AC090286 Genomic DNA. No translation available.
BC034380 mRNA. Translation: AAH34380.1.
BC039868 mRNA. Translation: AAH39868.1.
BC062617 mRNA. Translation: AAH62617.1.
CCDSiCCDS11201.2. [A0PJK1-4]
CCDS42275.1. [A0PJK1-1]
CCDS59277.1. [A0PJK1-5]
CCDS59278.1. [A0PJK1-2]
RefSeqiNP_001035915.1. NM_001042450.2. [A0PJK1-1]
NP_001257577.1. NM_001270648.1. [A0PJK1-2]
NP_001257578.1. NM_001270649.1. [A0PJK1-5]
NP_001269346.1. NM_001282417.1. [A0PJK1-3]
NP_689564.3. NM_152351.4. [A0PJK1-4]
XP_006721514.1. XM_006721451.1. [A0PJK1-1]
UniGeneiHs.462418.

Genome annotation databases

EnsembliENST00000317977; ENSP00000324346; ENSG00000154025. [A0PJK1-3]
ENST00000395642; ENSP00000379004; ENSG00000154025. [A0PJK1-3]
ENST00000395643; ENSP00000379005; ENSG00000154025. [A0PJK1-2]
ENST00000395645; ENSP00000379007; ENSG00000154025. [A0PJK1-1]
ENST00000395647; ENSP00000379008; ENSG00000154025. [A0PJK1-4]
ENST00000417251; ENSP00000401875; ENSG00000154025. [A0PJK1-5]
GeneIDi125206.
KEGGihsa:125206.
UCSCiuc002gur.2. human. [A0PJK1-3]
uc002gut.2. human. [A0PJK1-4]
uc002guu.2. human. [A0PJK1-1]
uc002guv.2. human. [A0PJK1-2]
uc010vyl.2. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK057946 mRNA. Translation: BAB71619.1 . Sequence problems.
AK298345 mRNA. Translation: BAG60592.1 .
AC003957 Genomic DNA. No translation available.
AC090286 Genomic DNA. No translation available.
BC034380 mRNA. Translation: AAH34380.1 .
BC039868 mRNA. Translation: AAH39868.1 .
BC062617 mRNA. Translation: AAH62617.1 .
CCDSi CCDS11201.2. [A0PJK1-4 ]
CCDS42275.1. [A0PJK1-1 ]
CCDS59277.1. [A0PJK1-5 ]
CCDS59278.1. [A0PJK1-2 ]
RefSeqi NP_001035915.1. NM_001042450.2. [A0PJK1-1 ]
NP_001257577.1. NM_001270648.1. [A0PJK1-2 ]
NP_001257578.1. NM_001270649.1. [A0PJK1-5 ]
NP_001269346.1. NM_001282417.1. [A0PJK1-3 ]
NP_689564.3. NM_152351.4. [A0PJK1-4 ]
XP_006721514.1. XM_006721451.1. [A0PJK1-1 ]
UniGenei Hs.462418.

3D structure databases

ProteinModelPortali A0PJK1.
SMRi A0PJK1. Positions 17-480.
ModBasei Search...

Protein-protein interaction databases

MINTi MINT-4722994.
STRINGi 9606.ENSP00000379008.

Protein family/group databases

TCDBi 2.A.21.3.15. the solute:sodium symporter (sss) family.

PTM databases

PhosphoSitei A0PJK1.

Proteomic databases

PaxDbi A0PJK1.
PRIDEi A0PJK1.

Protocols and materials databases

DNASUi 125206.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000317977 ; ENSP00000324346 ; ENSG00000154025 . [A0PJK1-3 ]
ENST00000395642 ; ENSP00000379004 ; ENSG00000154025 . [A0PJK1-3 ]
ENST00000395643 ; ENSP00000379005 ; ENSG00000154025 . [A0PJK1-2 ]
ENST00000395645 ; ENSP00000379007 ; ENSG00000154025 . [A0PJK1-1 ]
ENST00000395647 ; ENSP00000379008 ; ENSG00000154025 . [A0PJK1-4 ]
ENST00000417251 ; ENSP00000401875 ; ENSG00000154025 . [A0PJK1-5 ]
GeneIDi 125206.
KEGGi hsa:125206.
UCSCi uc002gur.2. human. [A0PJK1-3 ]
uc002gut.2. human. [A0PJK1-4 ]
uc002guu.2. human. [A0PJK1-1 ]
uc002guv.2. human. [A0PJK1-2 ]
uc010vyl.2. human.

Organism-specific databases

CTDi 125206.
GeneCardsi GC17P018853.
H-InvDB HIX0018725.
HGNCi HGNC:23155. SLC5A10.
HPAi HPA052014.
neXtProti NX_A0PJK1.
PharmGKBi PA134940254.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG4146.
HOGENOMi HOG000025422.
HOVERGENi HBG052859.
KOi K14390.
OMAi HNERRIK.
OrthoDBi EOG77126J.
PhylomeDBi A0PJK1.
TreeFami TF352855.

Miscellaneous databases

ChiTaRSi SLC5A10. human.
GenomeRNAii 125206.
NextBioi 35473877.
PROi A0PJK1.

Gene expression databases

Bgeei A0PJK1.
CleanExi HS_SLC5A10.
Genevestigatori A0PJK1.

Family and domain databases

InterProi IPR001734. Na/solute_symporter.
IPR018212. Na/solute_symporter_CS.
IPR019900. Na/solute_symporter_subgr.
[Graphical view ]
PANTHERi PTHR11819. PTHR11819. 1 hit.
Pfami PF00474. SSF. 1 hit.
[Graphical view ]
TIGRFAMsi TIGR00813. sss. 1 hit.
PROSITEi PS00457. NA_SOLUT_SYMP_2. 1 hit.
PS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
    Tissue: Kidney.
  2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3-596 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-596 (ISOFORM 1).
    Tissue: Brain and Colon.
  4. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-141; SER-145 AND THR-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  5. "Functional characterisation of human SGLT-5 as a novel kidney-specific sodium-dependent sugar transporter."
    Grempler R., Augustin R., Froehner S., Hildebrandt T., Simon E., Mark M., Eickelmann P.
    FEBS Lett. 586:248-253(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 4 AND 5).

Entry informationi

Entry nameiSC5AA_HUMAN
AccessioniPrimary (citable) accession number: A0PJK1
Secondary accession number(s): A8MUC9
, B4DPI0, B7WPR4, Q6P5X0, Q8IXM4, Q96LQ1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: July 9, 2014
This is version 75 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi