Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/glucose cotransporter 5

Gene

SLC5A10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

High capacity transporter for mannose and fructose and, to a lesser extent, glucose, AMG, and galactose.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Transport

Keywords - Ligandi

Sodium

Protein family/group databases

TCDBi2.A.21.3.15. the solute:sodium symporter (sss) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/glucose cotransporter 5
Short name:
Na(+)/glucose cotransporter 5
Alternative name(s):
Solute carrier family 5 member 10
Gene namesi
Name:SLC5A10
Synonyms:SGLT5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:23155. SLC5A10.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1515ExtracellularSequence AnalysisAdd
BLAST
Transmembranei16 – 3621HelicalSequence AnalysisAdd
BLAST
Topological domaini37 – 7236CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei73 – 9321HelicalSequence AnalysisAdd
BLAST
Topological domaini94 – 996ExtracellularSequence Analysis
Transmembranei100 – 12021HelicalSequence AnalysisAdd
BLAST
Topological domaini121 – 14929CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei150 – 17021HelicalSequence AnalysisAdd
BLAST
Topological domaini171 – 1733ExtracellularSequence Analysis
Transmembranei174 – 19421HelicalSequence AnalysisAdd
BLAST
Topological domaini195 – 2006CytoplasmicSequence Analysis
Transmembranei201 – 22121HelicalSequence AnalysisAdd
BLAST
Topological domaini222 – 26443ExtracellularSequence AnalysisAdd
BLAST
Transmembranei265 – 28521HelicalSequence AnalysisAdd
BLAST
Topological domaini286 – 30015CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei301 – 32121HelicalSequence AnalysisAdd
BLAST
Topological domaini322 – 35534ExtracellularSequence AnalysisAdd
BLAST
Transmembranei356 – 37621HelicalSequence AnalysisAdd
BLAST
Topological domaini377 – 40933CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei410 – 43021HelicalSequence AnalysisAdd
BLAST
Topological domaini431 – 44313ExtracellularSequence AnalysisAdd
BLAST
Transmembranei444 – 46421HelicalSequence AnalysisAdd
BLAST
Topological domaini465 – 4717CytoplasmicSequence Analysis
Transmembranei472 – 49221HelicalSequence AnalysisAdd
BLAST
Topological domaini493 – 51321ExtracellularSequence AnalysisAdd
BLAST
Transmembranei514 – 53421HelicalSequence AnalysisAdd
BLAST
Topological domaini535 – 57541CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei576 – 59621HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134940254.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 596596Sodium/glucose cotransporter 5PRO_0000311211Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi4 – 41N-linked (GlcNAc...)Sequence Analysis
Glycosylationi96 – 961N-linked (GlcNAc...)Sequence Analysis
Modified residuei141 – 1411Phosphoserine1 Publication
Modified residuei145 – 1451Phosphoserine1 Publication
Modified residuei148 – 1481Phosphothreonine1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiA0PJK1.
PRIDEiA0PJK1.

PTM databases

PhosphoSiteiA0PJK1.

Expressioni

Tissue specificityi

Seems to be exclusively expressed in kidney.1 Publication

Gene expression databases

BgeeiA0PJK1.
CleanExiHS_SLC5A10.
GenevisibleiA0PJK1. HS.

Organism-specific databases

HPAiHPA052014.

Interactioni

Protein-protein interaction databases

MINTiMINT-4722994.
STRINGi9606.ENSP00000379008.

Structurei

3D structure databases

ProteinModelPortaliA0PJK1.
SMRiA0PJK1. Positions 17-480.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG4146.
GeneTreeiENSGT00760000118955.
HOGENOMiHOG000025422.
HOVERGENiHBG052859.
InParanoidiA0PJK1.
KOiK14390.
OMAiLIEGWLA.
OrthoDBiEOG77126J.
PhylomeDBiA0PJK1.
TreeFamiTF352855.

Family and domain databases

InterProiIPR001734. Na/solute_symporter.
IPR018212. Na/solute_symporter_CS.
IPR019900. Na/solute_symporter_subgr.
[Graphical view]
PANTHERiPTHR11819. PTHR11819. 1 hit.
PfamiPF00474. SSF. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00813. sss. 1 hit.
PROSITEiPS00457. NA_SOLUT_SYMP_2. 1 hit.
PS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A0PJK1-1) [UniParc]FASTAAdd to basket

Also known as: IF2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAANSTSDLH TPGTQLSVAD IIVITVYFAL NVAVGIWSSC RASRNTVNGY
60 70 80 90 100
FLAGRDMTWW PIGASLFASS EGSGLFIGLA GSGAAGGLAV AGFEWNATYV
110 120 130 140 150
LLALAWVFVP IYISSEIVTL PEYIQKRYGG QRIRMYLSVL SLLLSVFTKI
160 170 180 190 200
SLDLYAGALF VHICLGWNFY LSTILTLGIT ALYTIAGGLA AVIYTDALQT
210 220 230 240 250
LIMVVGAVIL TIKAFDQIGG YGQLEAAYAQ AIPSRTIANT TCHLPRTDAM
260 270 280 290 300
HMFRDPHTGD LPWTGMTFGL TIMATWYWCT DQVIVQRSLS ARDLNHAKAG
310 320 330 340 350
SILASYLKML PMGLIIMPGM ISRALFPDDV GCVVPSECLR ACGAEVGCSN
360 370 380 390 400
IAYPKLVMEL MPIGLRGLMI AVMLAALMSS LTSIFNSSST LFTMDIWRRL
410 420 430 440 450
RPRSGERELL LVGRLVIVAL IGVSVAWIPV LQDSNSGQLF IYMQSVTSSL
460 470 480 490 500
APPVTAVFVL GVFWRRANEQ GAFWGLIAGL VVGATRLVLE FLNPAPPCGE
510 520 530 540 550
PDTRPAVLGS IHYLHFAVAL FALSGAVVVA GSLLTPPPQS VQIENLTWWT
560 570 580 590
LAQDVPLGTK AGDGQTPQKH AFWARVCGFN AILLMCVNIF FYAYFA
Length:596
Mass (Da):64,342
Last modified:November 13, 2007 - v2
Checksum:i73D104A9F8065926
GO
Isoform 2 (identifier: A0PJK1-2) [UniParc]FASTAAdd to basket

Also known as: IF3

The sequence of this isoform differs from the canonical sequence as follows:
     187-213: Missing.

Show »
Length:569
Mass (Da):61,616
Checksum:i21794598680FDE9F
GO
Isoform 3 (identifier: A0PJK1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: Missing.
     187-213: Missing.
     327-327: P → PGAHVYEERHQVSVSRT
     414-414: R → RTGIPSTPPAPQSRLSFLLPETPPLERYLLGLVVMDLW

Note: No experimental confirmation available.
Show »
Length:566
Mass (Da):61,613
Checksum:iE4C754BBFC76F6C2
GO
Isoform 4 (identifier: A0PJK1-4) [UniParc]FASTAAdd to basket

Also known as: IF1

The sequence of this isoform differs from the canonical sequence as follows:
     327-327: P → PGAHVYEERHQVSVSRT

Show »
Length:612
Mass (Da):66,179
Checksum:iD9B55F5C1B9A97A8
GO
Isoform 5 (identifier: A0PJK1-5) [UniParc]FASTAAdd to basket

Also known as: IF4

The sequence of this isoform differs from the canonical sequence as follows:
     328-363: Missing.

Show »
Length:560
Mass (Da):60,577
Checksum:iB099BDCD16D8B738
GO

Sequence cautioni

The sequence BAB71619.1 differs from that shown. Reason: Frameshift at position 156. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti522 – 5221A → V.
Corresponds to variant rs12604020 [ dbSNP | Ensembl ].
VAR_052493

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5656Missing in isoform 3. 1 PublicationVSP_029416Add
BLAST
Alternative sequencei187 – 21327Missing in isoform 2 and isoform 3. 1 PublicationVSP_029417Add
BLAST
Alternative sequencei327 – 3271P → PGAHVYEERHQVSVSRT in isoform 3 and isoform 4. 2 PublicationsVSP_029418
Alternative sequencei328 – 36336Missing in isoform 5. 1 PublicationVSP_045061Add
BLAST
Alternative sequencei414 – 4141R → RTGIPSTPPAPQSRLSFLLP ETPPLERYLLGLVVMDLW in isoform 3. 1 PublicationVSP_029419

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057946 mRNA. Translation: BAB71619.1. Sequence problems.
AK298345 mRNA. Translation: BAG60592.1.
AC003957 Genomic DNA. No translation available.
AC090286 Genomic DNA. No translation available.
BC034380 mRNA. Translation: AAH34380.1.
BC039868 mRNA. Translation: AAH39868.1.
BC062617 mRNA. Translation: AAH62617.1.
CCDSiCCDS11201.2. [A0PJK1-4]
CCDS42275.1. [A0PJK1-1]
CCDS59277.1. [A0PJK1-5]
CCDS59278.1. [A0PJK1-2]
CCDS74008.1. [A0PJK1-3]
RefSeqiNP_001035915.1. NM_001042450.2. [A0PJK1-1]
NP_001257577.1. NM_001270648.1. [A0PJK1-2]
NP_001257578.1. NM_001270649.1. [A0PJK1-5]
NP_001269346.1. NM_001282417.1. [A0PJK1-3]
NP_689564.3. NM_152351.4. [A0PJK1-4]
UniGeneiHs.462418.

Genome annotation databases

EnsembliENST00000317977; ENSP00000324346; ENSG00000154025. [A0PJK1-3]
ENST00000395643; ENSP00000379005; ENSG00000154025. [A0PJK1-2]
ENST00000395645; ENSP00000379007; ENSG00000154025.
ENST00000395647; ENSP00000379008; ENSG00000154025. [A0PJK1-4]
ENST00000417251; ENSP00000401875; ENSG00000154025. [A0PJK1-5]
GeneIDi125206.
KEGGihsa:125206.
UCSCiuc002gur.2. human. [A0PJK1-3]
uc002gut.2. human. [A0PJK1-4]
uc002guu.2. human. [A0PJK1-1]
uc002guv.2. human. [A0PJK1-2]
uc010vyl.2. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057946 mRNA. Translation: BAB71619.1. Sequence problems.
AK298345 mRNA. Translation: BAG60592.1.
AC003957 Genomic DNA. No translation available.
AC090286 Genomic DNA. No translation available.
BC034380 mRNA. Translation: AAH34380.1.
BC039868 mRNA. Translation: AAH39868.1.
BC062617 mRNA. Translation: AAH62617.1.
CCDSiCCDS11201.2. [A0PJK1-4]
CCDS42275.1. [A0PJK1-1]
CCDS59277.1. [A0PJK1-5]
CCDS59278.1. [A0PJK1-2]
CCDS74008.1. [A0PJK1-3]
RefSeqiNP_001035915.1. NM_001042450.2. [A0PJK1-1]
NP_001257577.1. NM_001270648.1. [A0PJK1-2]
NP_001257578.1. NM_001270649.1. [A0PJK1-5]
NP_001269346.1. NM_001282417.1. [A0PJK1-3]
NP_689564.3. NM_152351.4. [A0PJK1-4]
UniGeneiHs.462418.

3D structure databases

ProteinModelPortaliA0PJK1.
SMRiA0PJK1. Positions 17-480.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-4722994.
STRINGi9606.ENSP00000379008.

Protein family/group databases

TCDBi2.A.21.3.15. the solute:sodium symporter (sss) family.

PTM databases

PhosphoSiteiA0PJK1.

Proteomic databases

PaxDbiA0PJK1.
PRIDEiA0PJK1.

Protocols and materials databases

DNASUi125206.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317977; ENSP00000324346; ENSG00000154025. [A0PJK1-3]
ENST00000395643; ENSP00000379005; ENSG00000154025. [A0PJK1-2]
ENST00000395645; ENSP00000379007; ENSG00000154025.
ENST00000395647; ENSP00000379008; ENSG00000154025. [A0PJK1-4]
ENST00000417251; ENSP00000401875; ENSG00000154025. [A0PJK1-5]
GeneIDi125206.
KEGGihsa:125206.
UCSCiuc002gur.2. human. [A0PJK1-3]
uc002gut.2. human. [A0PJK1-4]
uc002guu.2. human. [A0PJK1-1]
uc002guv.2. human. [A0PJK1-2]
uc010vyl.2. human.

Organism-specific databases

CTDi125206.
GeneCardsiGC17P018853.
H-InvDBHIX0018725.
HGNCiHGNC:23155. SLC5A10.
HPAiHPA052014.
neXtProtiNX_A0PJK1.
PharmGKBiPA134940254.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG4146.
GeneTreeiENSGT00760000118955.
HOGENOMiHOG000025422.
HOVERGENiHBG052859.
InParanoidiA0PJK1.
KOiK14390.
OMAiLIEGWLA.
OrthoDBiEOG77126J.
PhylomeDBiA0PJK1.
TreeFamiTF352855.

Miscellaneous databases

ChiTaRSiSLC5A10. human.
GenomeRNAii125206.
NextBioi35473877.
PROiA0PJK1.

Gene expression databases

BgeeiA0PJK1.
CleanExiHS_SLC5A10.
GenevisibleiA0PJK1. HS.

Family and domain databases

InterProiIPR001734. Na/solute_symporter.
IPR018212. Na/solute_symporter_CS.
IPR019900. Na/solute_symporter_subgr.
[Graphical view]
PANTHERiPTHR11819. PTHR11819. 1 hit.
PfamiPF00474. SSF. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00813. sss. 1 hit.
PROSITEiPS00457. NA_SOLUT_SYMP_2. 1 hit.
PS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
    Tissue: Kidney.
  2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3-596 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-596 (ISOFORM 1).
    Tissue: Brain and Colon.
  4. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-141; SER-145 AND THR-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  5. "Functional characterisation of human SGLT-5 as a novel kidney-specific sodium-dependent sugar transporter."
    Grempler R., Augustin R., Froehner S., Hildebrandt T., Simon E., Mark M., Eickelmann P.
    FEBS Lett. 586:248-253(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 4 AND 5).

Entry informationi

Entry nameiSC5AA_HUMAN
AccessioniPrimary (citable) accession number: A0PJK1
Secondary accession number(s): A8MUC9
, B4DPI0, B7WPR4, Q6P5X0, Q8IXM4, Q96LQ1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: July 22, 2015
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.