SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A0AV02

- S12A8_HUMAN

UniProt

A0AV02 - S12A8_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Solute carrier family 12 member 8
Gene
SLC12A8, CCC9
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Cation/chloride cotransporter that may play a role in the control of keratinocyte proliferation.1 Publication

GO - Molecular functioni

  1. symporter activity Source: UniProtKB-KW

GO - Biological processi

  1. potassium ion transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Ion transport, Potassium transport, Symport, Transport

Keywords - Ligandi

Chloride, Potassium

Protein family/group databases

TCDBi2.A.30.3.4. the cation-chloride cotransporter (ccc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 12 member 8
Alternative name(s):
Cation-chloride cotransporter 9
Gene namesi
Name:SLC12A8
Synonyms:CCC9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:15595. SLC12A8.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei37 – 6024Helical; Reviewed prediction
Add
BLAST
Transmembranei72 – 9322Helical; Reviewed prediction
Add
BLAST
Transmembranei99 – 11618Helical; Reviewed prediction
Add
BLAST
Transmembranei123 – 14220Helical; Reviewed prediction
Add
BLAST
Transmembranei154 – 17320Helical; Reviewed prediction
Add
BLAST
Transmembranei185 – 20521Helical; Reviewed prediction
Add
BLAST
Transmembranei233 – 25422Helical; Reviewed prediction
Add
BLAST
Transmembranei266 – 28924Helical; Reviewed prediction
Add
BLAST
Transmembranei309 – 33123Helical; Reviewed prediction
Add
BLAST
Transmembranei360 – 37718Helical; Reviewed prediction
Add
BLAST
Transmembranei383 – 40321Helical; Reviewed prediction
Add
BLAST
Transmembranei593 – 61624Helical; Reviewed prediction
Add
BLAST
Transmembranei622 – 64322Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Involvement in diseasei

SLC12A8 has been identified as a possible susceptibility gene for psoriasis mapped to chromosome 3q21 (PSORS5).

Organism-specific databases

PharmGKBiPA37991.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 714714Solute carrier family 12 member 8
PRO_0000305287Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi221 – 2211N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiA0AV02.
PaxDbiA0AV02.
PRIDEiA0AV02.

PTM databases

PhosphoSiteiA0AV02.

Expressioni

Tissue specificityi

Ubiquitous with very low level in normal skin.1 Publication

Gene expression databases

ArrayExpressiA0AV02.
BgeeiA0AV02.
GenevestigatoriA0AV02.

Organism-specific databases

HPAiHPA031123.

Structurei

3D structure databases

ProteinModelPortaliA0AV02.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0531.
HOVERGENiHBG108430.
InParanoidiA0AV02.
KOiK14428.
OMAiGRGPNKV.
OrthoDBiEOG7VB2DV.
PhylomeDBiA0AV02.
TreeFamiTF313191.

Family and domain databases

InterProiIPR004841. AA-permease/SLC12A_dom.
[Graphical view]
PfamiPF00324. AA_permease. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A0AV02-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTQMSQVQEL FHEAAQQDAL AQPQPWWKTQ LFMWEPVLFG TWDGVFTSCM    50
INIFGVVLFL RTGWLVGNTG VLLGMFLVSF VILVALVTVL SGIGVGERSS 100
IGSGGVYSMI SSVLGGQTGG TIGLLYVFGQ CVAGAMYITG FAESISDLLG 150
LGNIWAVRGI SVAVLLALLG INLAGVKWII RLQLLLLFLL AVSTLDFVVG 200
SFTHLDPEHG FIGYSPELLQ NNTLPDYSPG ESFFTVFGVF FPAATGVMAG 250
FNMGGDLREP AASIPPGSLA AVGISWFLYI IFVFLLGAIC TREALRYDFL 300
IAEKVSLMGF LFLLGLYISS LASCMGGLYG APRILQCIAQ EKVIPALACL 350
GQGKGPNKTP VAAICLTSLV TMAFVFVGQV NVLAPIVTIN FMLTYVAVDY 400
SYFSLSMCSC SLTPVPEPVL REGAEGLHCS EHLLLEKAPS YGSEGPAQRV 450
LEGTLLEFTK DMDQLLQLTR KLESSQPRQG EGNRTPESQK RKSKKATKQT 500
LQDSFLLDLK SPPSFPVEIS DRLPAASWEG QESCWNKQTS KSEGTQPEGT 550
YGEQLVPELC NQSESSGEDF FLKSRLQEQD VWRRSTSFYT HMCNPWVSLL 600
GAVGSLLIMF VIQWVYTLVN MGVAAIVYFY IGRASPGLHL GSASNFSFFR 650
WMRSLLLPSC RSLRSPQEQI ILAPSLAKVD MEMTQLTQEN ADFATRDRYH 700
HSSLVNREQL MPHY 714
Length:714
Mass (Da):78,223
Last modified:May 18, 2010 - v3
Checksum:i9B7C070C2FB04507
GO
Isoform 2 (identifier: A0AV02-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MTQMSQVQELFHEAAQQ → MLPLERTITYRDMSSFIQVKNHFNVVNVTCVSYRSTCFRDMRRFIL

Note: No experimental confirmation available.

Show »
Length:743
Mass (Da):81,806
Checksum:i1707569985931744
GO
Isoform 3 (identifier: A0AV02-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-199: Missing.
     200-245: GSFTHLDPEH...VFGVFFPAAT → MRRAAAGGLA...SPHSPSGCLS

Note: No experimental confirmation available.

Show »
Length:515
Mass (Da):56,160
Checksum:i6107608E3AA3990C
GO
Isoform 4 (identifier: A0AV02-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-247: Missing.
     569-661: DFFLKSRLQE...MRSLLLPSCR → G

Note: No experimental confirmation available.

Show »
Length:375
Mass (Da):41,059
Checksum:iBFE78B167C8FEB09
GO
Isoform 5 (identifier: A0AV02-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-406: Missing.

Note: No experimental confirmation available.

Show »
Length:308
Mass (Da):34,799
Checksum:iAF232C6971B2A80C
GO

Sequence cautioni

The sequence AAH63528.1 differs from that shown. Reason: Frameshift at position 569.
The sequence AAH20506.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence AAH63528.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence AAM73657.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence CAD97969.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence AAK94307.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti181 – 1811R → C.1 Publication
Corresponds to variant rs2993631 [ dbSNP | Ensembl ].
VAR_035199
Natural varianti266 – 2661P → L.
Corresponds to variant rs863642 [ dbSNP | Ensembl ].
VAR_035200
Natural varianti281 – 2811I → V.3 Publications
Corresponds to variant rs621383 [ dbSNP | Ensembl ].
VAR_062148
Natural varianti541 – 5411K → R.
Corresponds to variant rs6773138 [ dbSNP | Ensembl ].
VAR_035201
Natural varianti664 – 6641R → Q.1 Publication
Corresponds to variant rs2981482 [ dbSNP | Ensembl ].
VAR_035202

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 406406Missing in isoform 5.
VSP_028327Add
BLAST
Alternative sequencei1 – 247247Missing in isoform 4.
VSP_028328Add
BLAST
Alternative sequencei1 – 199199Missing in isoform 3.
VSP_028329Add
BLAST
Alternative sequencei1 – 1717MTQMS…EAAQQ → MLPLERTITYRDMSSFIQVK NHFNVVNVTCVSYRSTCFRD MRRFIL in isoform 2.
VSP_028330Add
BLAST
Alternative sequencei200 – 24546GSFTH…FPAAT → MRRAAAGGLAVGQLPGEGPA GEEGAALGKAMRGGGCSPHS PSGCLS in isoform 3.
VSP_028331Add
BLAST
Alternative sequencei569 – 66193DFFLK…LPSCR → G in isoform 4.
VSP_028332Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti111 – 1111S → P in CAH18426. 1 Publication
Sequence conflicti319 – 3191S → P in AAM73657. 1 Publication
Sequence conflicti433 – 4331L → P in CAG33644. 1 Publication
Sequence conflicti481 – 4811E → D in BAB15571. 1 Publication
Sequence conflicti512 – 5121P → L in CAH18426. 1 Publication
Sequence conflicti555 – 5551L → P in CAD97969. 1 Publication
Sequence conflicti698 – 6981R → H in AAO49174. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF389851 Genomic DNA. Translation: AAK94307.1. Sequence problems.
AF390442 mRNA. Translation: AAM73657.1. Different initiation.
AF345197 mRNA. Translation: AAO49174.1.
AK026841 mRNA. Translation: BAB15571.1.
BX538023 mRNA. Translation: CAD97969.1. Different initiation.
CR749632 mRNA. Translation: CAH18426.1.
AC055752 Genomic DNA. No translation available.
AC108688 Genomic DNA. No translation available.
AC117488 Genomic DNA. No translation available.
BC020506 mRNA. Translation: AAH20506.1. Different initiation.
BC063528 mRNA. Translation: AAH63528.1. Sequence problems.
BC126158 mRNA. Translation: AAI26159.1.
BC126160 mRNA. Translation: AAI26161.1.
CR457363 mRNA. Translation: CAG33644.1.
CCDSiCCDS43143.1. [A0AV02-1]
RefSeqiNP_001182412.1. NM_001195483.1.
NP_078904.3. NM_024628.5.
UniGeneiHs.658514.

Genome annotation databases

EnsembliENST00000393469; ENSP00000377112; ENSG00000221955. [A0AV02-1]
ENST00000423114; ENSP00000404243; ENSG00000221955. [A0AV02-2]
ENST00000430155; ENSP00000415713; ENSG00000221955. [A0AV02-3]
ENST00000469902; ENSP00000418783; ENSG00000221955. [A0AV02-1]
GeneIDi84561.
KEGGihsa:84561.
UCSCiuc003eht.4. human. [A0AV02-3]
uc003ehv.4. human. [A0AV02-1]
uc003ehw.4. human. [A0AV02-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF389851 Genomic DNA. Translation: AAK94307.1 . Sequence problems.
AF390442 mRNA. Translation: AAM73657.1 . Different initiation.
AF345197 mRNA. Translation: AAO49174.1 .
AK026841 mRNA. Translation: BAB15571.1 .
BX538023 mRNA. Translation: CAD97969.1 . Different initiation.
CR749632 mRNA. Translation: CAH18426.1 .
AC055752 Genomic DNA. No translation available.
AC108688 Genomic DNA. No translation available.
AC117488 Genomic DNA. No translation available.
BC020506 mRNA. Translation: AAH20506.1 . Different initiation.
BC063528 mRNA. Translation: AAH63528.1 . Sequence problems.
BC126158 mRNA. Translation: AAI26159.1 .
BC126160 mRNA. Translation: AAI26161.1 .
CR457363 mRNA. Translation: CAG33644.1 .
CCDSi CCDS43143.1. [A0AV02-1 ]
RefSeqi NP_001182412.1. NM_001195483.1.
NP_078904.3. NM_024628.5.
UniGenei Hs.658514.

3D structure databases

ProteinModelPortali A0AV02.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

TCDBi 2.A.30.3.4. the cation-chloride cotransporter (ccc) family.

PTM databases

PhosphoSitei A0AV02.

Proteomic databases

MaxQBi A0AV02.
PaxDbi A0AV02.
PRIDEi A0AV02.

Protocols and materials databases

DNASUi 84561.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000393469 ; ENSP00000377112 ; ENSG00000221955 . [A0AV02-1 ]
ENST00000423114 ; ENSP00000404243 ; ENSG00000221955 . [A0AV02-2 ]
ENST00000430155 ; ENSP00000415713 ; ENSG00000221955 . [A0AV02-3 ]
ENST00000469902 ; ENSP00000418783 ; ENSG00000221955 . [A0AV02-1 ]
GeneIDi 84561.
KEGGi hsa:84561.
UCSCi uc003eht.4. human. [A0AV02-3 ]
uc003ehv.4. human. [A0AV02-1 ]
uc003ehw.4. human. [A0AV02-2 ]

Organism-specific databases

CTDi 84561.
GeneCardsi GC03M124832.
HGNCi HGNC:15595. SLC12A8.
HPAi HPA031123.
MIMi 611316. gene.
neXtProti NX_A0AV02.
PharmGKBi PA37991.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0531.
HOVERGENi HBG108430.
InParanoidi A0AV02.
KOi K14428.
OMAi GRGPNKV.
OrthoDBi EOG7VB2DV.
PhylomeDBi A0AV02.
TreeFami TF313191.

Miscellaneous databases

ChiTaRSi SLC12A8. human.
GeneWikii SLC12A8.
GenomeRNAii 84561.
NextBioi 74454.
PROi A0AV02.
SOURCEi Search...

Gene expression databases

ArrayExpressi A0AV02.
Bgeei A0AV02.
Genevestigatori A0AV02.

Family and domain databases

InterProi IPR004841. AA-permease/SLC12A_dom.
[Graphical view ]
Pfami PF00324. AA_permease. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a psoriasis susceptibility candidate gene by linkage disequilibrium mapping with a localized single nucleotide polymorphism map."
    Hewett D., Samuelsson L., Polding J., Enlund F., Smart D., Cantone K., See C.G., Chadha S., Inerot A., Enerback C., Montgomery D., Christodolou C., Robinson P., Matthews P., Plumpton M., Wahlstrom J., Swanbeck G., Martinsson T.
    , Roses A., Riley J., Purvis I.
    Genomics 79:305-314(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUSCEPTIBILITY TO PSORIASIS, FUNCTION, TISSUE SPECIFICITY, VARIANTS CYS-181 AND VAL-281.
  2. "Characterization of Homo sapiens CCC9, a novel member of the cation-chloride cotransporter gene family."
    Mount D.B.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-281 AND GLN-664.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Lung.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Endometrial adenocarcinoma and Salivary gland.
  5. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT VAL-281.
    Tissue: Colon and Lymph.
  7. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 407-714 (ISOFORM 1).
  8. "Systematic linkage disequilibrium analysis of SLC12A8 at PSORS5 confirms a role in susceptibility to psoriasis vulgaris."
    Hueffmeier U., Lascorz J., Traupe H., Boehm B., Schuermeier-Horst F., Staender M., Kelsch R., Baumann C., Kuester W., Burkhardt H., Reis A.
    J. Invest. Dermatol. 125:906-912(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUSCEPTIBILITY TO PSORIASIS.

Entry informationi

Entry nameiS12A8_HUMAN
AccessioniPrimary (citable) accession number: A0AV02
Secondary accession number(s): C9JJJ2
, Q68D04, Q6I9Z2, Q6P4C0, Q7Z3A6, Q86WK0, Q8NFX9, Q8WUI3, Q96RF9, Q9H5P9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: May 18, 2010
Last modified: July 9, 2014
This is version 60 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi